BLASTX nr result
ID: Achyranthes23_contig00002778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00002778 (217 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM64831.1| hypothetical protein [Beta vulgaris] 57 2e-06 >dbj|BAM64831.1| hypothetical protein [Beta vulgaris] Length = 126 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -1 Query: 148 MAAVNSSGRVTSFGKRFVTRVLTQSSTPTRSLSAGAPTLRRSLHGSVYD 2 MAA +S VTSFGKR VT+++TQSS PTR LSA AP RRSLH SVYD Sbjct: 1 MAANSSYRGVTSFGKRVVTQIVTQSS-PTRPLSA-APVFRRSLHASVYD 47