BLASTX nr result
ID: Achyranthes23_contig00002414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00002414 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006380780.1| hypothetical protein POPTR_0007s13500g [Popu... 56 4e-06 ref|XP_002310828.2| hypothetical protein POPTR_0007s13500g [Popu... 56 4e-06 emb|CBI17437.3| unnamed protein product [Vitis vinifera] 56 4e-06 ref|XP_002268002.1| PREDICTED: d-2-hydroxyglutarate dehydrogenas... 56 4e-06 gb|AFK45705.1| unknown [Medicago truncatula] 55 7e-06 ref|XP_003612098.1| D-2-hydroxyglutarate dehydrogenase [Medicago... 55 7e-06 gb|EPS68480.1| hypothetical protein M569_06288, partial [Genlise... 55 1e-05 >ref|XP_006380780.1| hypothetical protein POPTR_0007s13500g [Populus trichocarpa] gi|550334807|gb|ERP58577.1| hypothetical protein POPTR_0007s13500g [Populus trichocarpa] Length = 360 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 229 GSEGSLGLVTKVFKLTPPKLSAINVVILACNDYLN 125 GSEGSLG+VTKV LTPPKLS++N+ LAC DYL+ Sbjct: 263 GSEGSLGIVTKVSILTPPKLSSVNIAFLACEDYLS 297 >ref|XP_002310828.2| hypothetical protein POPTR_0007s13500g [Populus trichocarpa] gi|550334806|gb|EEE91278.2| hypothetical protein POPTR_0007s13500g [Populus trichocarpa] Length = 480 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 229 GSEGSLGLVTKVFKLTPPKLSAINVVILACNDYLN 125 GSEGSLG+VTKV LTPPKLS++N+ LAC DYL+ Sbjct: 263 GSEGSLGIVTKVSILTPPKLSSVNIAFLACEDYLS 297 >emb|CBI17437.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 229 GSEGSLGLVTKVFKLTPPKLSAINVVILACNDYLN 125 GSEGSLG+VTKV LTPPKLS++NV LAC DYL+ Sbjct: 165 GSEGSLGVVTKVSILTPPKLSSVNVAFLACKDYLS 199 >ref|XP_002268002.1| PREDICTED: d-2-hydroxyglutarate dehydrogenase, mitochondrial-like [Vitis vinifera] Length = 552 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 229 GSEGSLGLVTKVFKLTPPKLSAINVVILACNDYLN 125 GSEGSLG+VTKV LTPPKLS++NV LAC DYL+ Sbjct: 282 GSEGSLGVVTKVSILTPPKLSSVNVAFLACKDYLS 316 >gb|AFK45705.1| unknown [Medicago truncatula] Length = 373 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 229 GSEGSLGLVTKVFKLTPPKLSAINVVILACNDY 131 GSEGSLG+VTKV LTPPKLS++NV +LAC DY Sbjct: 293 GSEGSLGIVTKVSILTPPKLSSVNVALLACKDY 325 >ref|XP_003612098.1| D-2-hydroxyglutarate dehydrogenase [Medicago truncatula] gi|355513433|gb|AES95056.1| D-2-hydroxyglutarate dehydrogenase [Medicago truncatula] Length = 724 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 229 GSEGSLGLVTKVFKLTPPKLSAINVVILACNDY 131 GSEGSLG+VTKV LTPPKLS++NV +LAC DY Sbjct: 293 GSEGSLGIVTKVSILTPPKLSSVNVALLACKDY 325 >gb|EPS68480.1| hypothetical protein M569_06288, partial [Genlisea aurea] Length = 502 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 229 GSEGSLGLVTKVFKLTPPKLSAINVVILACNDY 131 GSEGSLG+VTKV LTPPKL+++NVV LAC DY Sbjct: 238 GSEGSLGIVTKVSILTPPKLASVNVVFLACEDY 270