BLASTX nr result
ID: Achyranthes23_contig00002126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00002126 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003580447.1| PREDICTED: probable WRKY transcription facto... 91 1e-16 ref|XP_006652776.1| PREDICTED: probable WRKY transcription facto... 90 3e-16 ref|NP_001053792.1| Os04g0605100 [Oryza sativa Japonica Group] g... 88 1e-15 emb|CBI17876.3| unnamed protein product [Vitis vinifera] 87 3e-15 gb|ACY25182.1| WRKY [Vitis vinifera] 87 3e-15 ref|XP_002266188.1| PREDICTED: probable WRKY transcription facto... 87 3e-15 gb|EMT29238.1| Putative WRKY transcription factor 11 [Aegilops t... 86 4e-15 gb|EMS61783.1| putative WRKY transcription factor 11 [Triticum u... 86 4e-15 gb|ABI13373.1| WRKY transcription factor 7 [Hordeum vulgare subs... 86 4e-15 gb|ABO15546.1| WRKY68-b transcription factor [Triticum aestivum] 86 4e-15 gb|ABN43181.1| WRKY transcription factor [Triticum aestivum] 86 4e-15 ref|XP_004976718.1| PREDICTED: probable WRKY transcription facto... 86 5e-15 gb|AFW59358.1| putative WRKY DNA-binding domain superfamily prot... 86 5e-15 ref|XP_002447056.1| hypothetical protein SORBIDRAFT_06g027710 [S... 86 5e-15 gb|ACR37764.1| unknown [Zea mays] gi|323388799|gb|ADX60204.1| WR... 86 5e-15 gb|ACG45417.1| WRKY68 - superfamily of TFs having WRKY and zinc ... 86 5e-15 gb|ACF80531.1| unknown [Zea mays] gi|414585572|tpg|DAA36143.1| T... 86 5e-15 gb|ACD80377.1| WRKY20 transcription factor, partial [Triticum ae... 86 5e-15 ref|XP_003588631.1| WRKY transcription factor [Medicago truncatu... 86 7e-15 ref|XP_002515353.1| WRKY transcription factor, putative [Ricinus... 86 7e-15 >ref|XP_003580447.1| PREDICTED: probable WRKY transcription factor 11-like [Brachypodium distachyon] Length = 311 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVP 125 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRHSPVP Sbjct: 244 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHSPVP 284 >ref|XP_006652776.1| PREDICTED: probable WRKY transcription factor 17-like [Oryza brachyantha] Length = 307 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVP 125 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+PVP Sbjct: 245 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTPVP 285 >ref|NP_001053792.1| Os04g0605100 [Oryza sativa Japonica Group] gi|38346908|emb|CAE03880.2| OSJNBb0015N08.8 [Oryza sativa Japonica Group] gi|46394390|tpg|DAA05133.1| TPA_inf: WRKY transcription factor 68 [Oryza sativa (indica cultivar-group)] gi|113565363|dbj|BAF15706.1| Os04g0605100 [Oryza sativa Japonica Group] gi|125549624|gb|EAY95446.1| hypothetical protein OsI_17287 [Oryza sativa Indica Group] gi|125591550|gb|EAZ31900.1| hypothetical protein OsJ_16065 [Oryza sativa Japonica Group] gi|215692405|dbj|BAG87825.1| unnamed protein product [Oryza sativa Japonica Group] gi|215706353|dbj|BAG93209.1| unnamed protein product [Oryza sativa Japonica Group] Length = 309 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/54 (74%), Positives = 44/54 (81%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVPAISHHHNIPSTPA 164 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+P P +P+ PA Sbjct: 243 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTPGP-------LPAPPA 289 >emb|CBI17876.3| unnamed protein product [Vitis vinifera] Length = 279 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/52 (76%), Positives = 42/52 (80%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVPAISHHHNIPST 158 GYYKCS+VRGCPARKHVERA DDP MLIVTYEGEHRHS PA + PST Sbjct: 228 GYYKCSSVRGCPARKHVERAPDDPAMLIVTYEGEHRHSQTPAPAGGLMFPST 279 >gb|ACY25182.1| WRKY [Vitis vinifera] Length = 297 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/52 (76%), Positives = 42/52 (80%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVPAISHHHNIPST 158 GYYKCS+VRGCPARKHVERA DDP MLIVTYEGEHRHS PA + PST Sbjct: 246 GYYKCSSVRGCPARKHVERAPDDPAMLIVTYEGEHRHSQTPAPAGGLMFPST 297 >ref|XP_002266188.1| PREDICTED: probable WRKY transcription factor 11 [Vitis vinifera] Length = 297 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/52 (76%), Positives = 42/52 (80%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVPAISHHHNIPST 158 GYYKCS+VRGCPARKHVERA DDP MLIVTYEGEHRHS PA + PST Sbjct: 246 GYYKCSSVRGCPARKHVERAPDDPAMLIVTYEGEHRHSQTPAPAGGLMFPST 297 >gb|EMT29238.1| Putative WRKY transcription factor 11 [Aegilops tauschii] Length = 178 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVP 125 GYYKCSTVRGCPARKHVERA DDP ML+VTYEGEHRHSP P Sbjct: 108 GYYKCSTVRGCPARKHVERALDDPAMLVVTYEGEHRHSPGP 148 >gb|EMS61783.1| putative WRKY transcription factor 11 [Triticum urartu] Length = 155 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVP 125 GYYKCSTVRGCPARKHVERA DDP ML+VTYEGEHRHSP P Sbjct: 85 GYYKCSTVRGCPARKHVERALDDPAMLVVTYEGEHRHSPGP 125 >gb|ABI13373.1| WRKY transcription factor 7 [Hordeum vulgare subsp. vulgare] gi|326507526|dbj|BAK03156.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 326 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVP 125 GYYKCSTVRGCPARKHVERA DDP ML+VTYEGEHRHSP P Sbjct: 254 GYYKCSTVRGCPARKHVERALDDPAMLVVTYEGEHRHSPGP 294 >gb|ABO15546.1| WRKY68-b transcription factor [Triticum aestivum] Length = 313 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVP 125 GYYKCSTVRGCPARKHVERA DDP ML+VTYEGEHRHSP P Sbjct: 243 GYYKCSTVRGCPARKHVERALDDPAMLVVTYEGEHRHSPGP 283 >gb|ABN43181.1| WRKY transcription factor [Triticum aestivum] Length = 328 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSPVP 125 GYYKCSTVRGCPARKHVERA DDP ML+VTYEGEHRHSP P Sbjct: 256 GYYKCSTVRGCPARKHVERALDDPAMLVVTYEGEHRHSPGP 296 >ref|XP_004976718.1| PREDICTED: probable WRKY transcription factor 11-like [Setaria italica] Length = 318 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSP 119 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+P Sbjct: 251 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTP 289 >gb|AFW59358.1| putative WRKY DNA-binding domain superfamily protein [Zea mays] Length = 316 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSP 119 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+P Sbjct: 246 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTP 284 >ref|XP_002447056.1| hypothetical protein SORBIDRAFT_06g027710 [Sorghum bicolor] gi|241938239|gb|EES11384.1| hypothetical protein SORBIDRAFT_06g027710 [Sorghum bicolor] Length = 315 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSP 119 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+P Sbjct: 252 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTP 290 >gb|ACR37764.1| unknown [Zea mays] gi|323388799|gb|ADX60204.1| WRKY transcription factor [Zea mays] gi|414585571|tpg|DAA36142.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea mays] Length = 298 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSP 119 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+P Sbjct: 233 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTP 271 >gb|ACG45417.1| WRKY68 - superfamily of TFs having WRKY and zinc finger domains [Zea mays] Length = 292 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSP 119 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+P Sbjct: 227 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTP 265 >gb|ACF80531.1| unknown [Zea mays] gi|414585572|tpg|DAA36143.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea mays] Length = 285 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSP 119 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+P Sbjct: 220 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTP 258 >gb|ACD80377.1| WRKY20 transcription factor, partial [Triticum aestivum] Length = 124 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHSP 119 GYYKCSTVRGCPARKHVERATDDP ML+VTYEGEHRH+P Sbjct: 61 GYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTP 99 >ref|XP_003588631.1| WRKY transcription factor [Medicago truncatula] gi|355477679|gb|AES58882.1| WRKY transcription factor [Medicago truncatula] Length = 340 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHS 116 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRH+ Sbjct: 283 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHT 320 >ref|XP_002515353.1| WRKY transcription factor, putative [Ricinus communis] gi|223545297|gb|EEF46802.1| WRKY transcription factor, putative [Ricinus communis] Length = 321 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHS 116 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRH+ Sbjct: 265 GYYKCSTVRGCPARKHVERATDDPTMLIVTYEGEHRHT 302