BLASTX nr result
ID: Achyranthes23_contig00001323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00001323 (477 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus pe... 118 7e-25 ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 117 2e-24 ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing... 116 3e-24 gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [... 114 1e-23 gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma... 114 1e-23 gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma... 114 1e-23 emb|CBI14900.3| unnamed protein product [Vitis vinifera] 114 1e-23 ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 114 1e-23 ref|XP_006439990.1| hypothetical protein CICLE_v10020762mg [Citr... 114 2e-23 ref|XP_004299170.1| PREDICTED: BTB/POZ and TAZ domain-containing... 110 2e-22 gb|EXB94438.1| BTB/POZ and TAZ domain-containing protein 1 [Moru... 110 3e-22 ref|XP_002322214.2| speckle-type POZ family protein [Populus tri... 105 6e-21 ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing... 100 2e-19 gb|AGV54691.1| BTB/POZ and TAZ domain-containing protein 2 [Phas... 100 2e-19 ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing... 100 2e-19 ref|XP_006376888.1| hypothetical protein POPTR_0012s09300g [Popu... 100 2e-19 ref|XP_006387987.1| speckle-type POZ family protein [Populus tri... 100 2e-19 ref|XP_002318693.1| predicted protein [Populus trichocarpa] 100 2e-19 ref|XP_004137576.1| PREDICTED: BTB/POZ and TAZ domain-containing... 99 4e-19 ref|XP_004515848.1| PREDICTED: BTB/POZ and TAZ domain-containing... 99 6e-19 >gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] Length = 413 Score = 118 bits (296), Expect = 7e-25 Identities = 55/81 (67%), Positives = 66/81 (81%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGC RCKRMWQLL+LH+S+C+Q CRVPLCRQFKLKMQQEKK DDA+W+LLVRKVV A+ Sbjct: 324 GGCLRCKRMWQLLRLHSSMCDQPDSCRVPLCRQFKLKMQQEKKKDDARWKLLVRKVVSAR 383 Query: 181 TISTLTPPKPQDHVTKFSTQC 243 TIS+L+ PK + T+C Sbjct: 384 TISSLSLPKRKREEELGETRC 404 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 117 bits (293), Expect = 2e-24 Identities = 53/69 (76%), Positives = 61/69 (88%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGCSRCKRMWQLL+LHAS+C+Q CRVPLCRQFKLKMQ EKKGDDA W+LLVRKVV A+ Sbjct: 274 GGCSRCKRMWQLLRLHASMCDQPDSCRVPLCRQFKLKMQHEKKGDDALWKLLVRKVVSAR 333 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 334 VLSSLSLPK 342 >ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Citrus sinensis] Length = 363 Score = 116 bits (291), Expect = 3e-24 Identities = 53/69 (76%), Positives = 60/69 (86%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGC RCKRMWQLL+LH+S+CEQ CRVPLCRQFKLK QQEKKGDD +WRLLV+KVV AK Sbjct: 274 GGCLRCKRMWQLLRLHSSMCEQSDSCRVPLCRQFKLKAQQEKKGDDGRWRLLVKKVVSAK 333 Query: 181 TISTLTPPK 207 TIS+L+ K Sbjct: 334 TISSLSQQK 342 >gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] Length = 253 Score = 114 bits (286), Expect = 1e-23 Identities = 51/69 (73%), Positives = 61/69 (88%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGCSRCKRMWQLL+LH+S+C+Q CRVPLCRQFKLK QQ++ GDDA W+LLVRKV+ AK Sbjct: 163 GGCSRCKRMWQLLRLHSSICDQPDSCRVPLCRQFKLKAQQQRMGDDALWKLLVRKVLSAK 222 Query: 181 TISTLTPPK 207 TIS+L+ PK Sbjct: 223 TISSLSLPK 231 >gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] Length = 334 Score = 114 bits (286), Expect = 1e-23 Identities = 51/69 (73%), Positives = 61/69 (88%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGCSRCKRMWQLL+LH+S+C+Q CRVPLCRQFKLK QQ++ GDDA W+LLVRKV+ AK Sbjct: 244 GGCSRCKRMWQLLRLHSSICDQPDSCRVPLCRQFKLKAQQQRMGDDALWKLLVRKVLSAK 303 Query: 181 TISTLTPPK 207 TIS+L+ PK Sbjct: 304 TISSLSLPK 312 >gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] Length = 354 Score = 114 bits (286), Expect = 1e-23 Identities = 51/69 (73%), Positives = 61/69 (88%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGCSRCKRMWQLL+LH+S+C+Q CRVPLCRQFKLK QQ++ GDDA W+LLVRKV+ AK Sbjct: 264 GGCSRCKRMWQLLRLHSSICDQPDSCRVPLCRQFKLKAQQQRMGDDALWKLLVRKVLSAK 323 Query: 181 TISTLTPPK 207 TIS+L+ PK Sbjct: 324 TISSLSLPK 332 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 114 bits (286), Expect = 1e-23 Identities = 51/69 (73%), Positives = 61/69 (88%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGCSRCKRMWQLL+LH+S+C+Q CRVPLCRQFKLK QQ KKG+DA+W+LLVRKVV AK Sbjct: 257 GGCSRCKRMWQLLRLHSSICDQTDLCRVPLCRQFKLKAQQVKKGEDARWKLLVRKVVSAK 316 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 317 AMSSLSLPK 325 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 114 bits (286), Expect = 1e-23 Identities = 51/69 (73%), Positives = 61/69 (88%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGCSRCKRMWQLL+LH+S+C+Q CRVPLCRQFKLK QQ KKG+DA+W+LLVRKVV AK Sbjct: 261 GGCSRCKRMWQLLRLHSSICDQTDLCRVPLCRQFKLKAQQVKKGEDARWKLLVRKVVSAK 320 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 321 AMSSLSLPK 329 >ref|XP_006439990.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] gi|557542252|gb|ESR53230.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] Length = 363 Score = 114 bits (284), Expect = 2e-23 Identities = 52/69 (75%), Positives = 59/69 (85%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGC RCKRMWQLL+LH+S+CEQ CRVPLCRQFKLK Q EKKGDD +WRLLV+KVV AK Sbjct: 274 GGCLRCKRMWQLLRLHSSMCEQSDSCRVPLCRQFKLKAQLEKKGDDGRWRLLVKKVVSAK 333 Query: 181 TISTLTPPK 207 TIS+L+ K Sbjct: 334 TISSLSQQK 342 >ref|XP_004299170.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 365 Score = 110 bits (275), Expect = 2e-22 Identities = 51/69 (73%), Positives = 58/69 (84%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGCSRCKRMWQLL+LH+S+C+Q CRVPLCRQFKLKM EKK DDA+W+LLVRKVV AK Sbjct: 272 GGCSRCKRMWQLLRLHSSMCDQSDSCRVPLCRQFKLKMIHEKKRDDARWKLLVRKVVSAK 331 Query: 181 TISTLTPPK 207 IS+L K Sbjct: 332 AISSLALAK 340 >gb|EXB94438.1| BTB/POZ and TAZ domain-containing protein 1 [Morus notabilis] Length = 344 Score = 110 bits (274), Expect = 3e-22 Identities = 49/69 (71%), Positives = 60/69 (86%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGC RCKRMWQLL+LH+S+CEQ CRVPLCRQFKL+M QEK+ DD++W+LLV+KVV AK Sbjct: 268 GGCLRCKRMWQLLRLHSSICEQSDSCRVPLCRQFKLRMLQEKRRDDSRWKLLVKKVVSAK 327 Query: 181 TISTLTPPK 207 TIS+L+ K Sbjct: 328 TISSLSLSK 336 >ref|XP_002322214.2| speckle-type POZ family protein [Populus trichocarpa] gi|550322402|gb|EEF06341.2| speckle-type POZ family protein [Populus trichocarpa] Length = 360 Score = 105 bits (262), Expect = 6e-21 Identities = 47/69 (68%), Positives = 57/69 (82%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 G CSRCKRMWQLL+LH+S+C+Q CRVPLCRQFKLKMQ EKKG + WRLLV+KV A+ Sbjct: 272 GKCSRCKRMWQLLRLHSSICDQTDSCRVPLCRQFKLKMQLEKKGVETLWRLLVKKVASAR 331 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 332 AMSSLSLPK 340 >ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 100 bits (250), Expect = 2e-19 Identities = 46/69 (66%), Positives = 57/69 (82%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGC RCKRMWQ+L+LHAS+C+Q C+VPLCRQFKLK+QQ KGDD W+ LVRKVV A+ Sbjct: 260 GGCLRCKRMWQILRLHASICDQPNDCQVPLCRQFKLKVQQ--KGDDELWKSLVRKVVSAR 317 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 318 AMSSLSLPK 326 >gb|AGV54691.1| BTB/POZ and TAZ domain-containing protein 2 [Phaseolus vulgaris] gi|561028860|gb|ESW27500.1| hypothetical protein PHAVU_003G207300g [Phaseolus vulgaris] Length = 351 Score = 100 bits (250), Expect = 2e-19 Identities = 46/70 (65%), Positives = 55/70 (78%), Gaps = 1/70 (1%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLG-PCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLA 177 GGC RCKRMWQL +LH+ VC Q C+VP CRQF+LKMQQEK+ DDAKW+LL RKV A Sbjct: 260 GGCVRCKRMWQLFRLHSYVCHQTDLSCKVPFCRQFQLKMQQEKRKDDAKWKLLARKVTSA 319 Query: 178 KTISTLTPPK 207 K +S+L+ PK Sbjct: 320 KVLSSLSLPK 329 >ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Solanum lycopersicum] Length = 349 Score = 100 bits (250), Expect = 2e-19 Identities = 46/69 (66%), Positives = 57/69 (82%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGC RCKRMWQ+L+LHAS+C+Q C+VPLCRQFKLK+QQ KGDD W+ LVRKVV A+ Sbjct: 260 GGCLRCKRMWQILRLHASICDQPNDCQVPLCRQFKLKVQQ--KGDDELWKSLVRKVVSAR 317 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 318 AMSSLSLPK 326 >ref|XP_006376888.1| hypothetical protein POPTR_0012s09300g [Populus trichocarpa] gi|550326732|gb|ERP54685.1| hypothetical protein POPTR_0012s09300g [Populus trichocarpa] Length = 364 Score = 100 bits (249), Expect = 2e-19 Identities = 44/69 (63%), Positives = 57/69 (82%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 G CSRCKRM QLL+LH+S+C+Q CRVPLCRQFKLKMQ+E++GD+ W LLV+KV A+ Sbjct: 276 GKCSRCKRMGQLLRLHSSICDQTDSCRVPLCRQFKLKMQRERRGDETLWSLLVKKVASAR 335 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 336 VMSSLSLPK 344 >ref|XP_006387987.1| speckle-type POZ family protein [Populus trichocarpa] gi|550309139|gb|ERP46901.1| speckle-type POZ family protein [Populus trichocarpa] Length = 364 Score = 100 bits (249), Expect = 2e-19 Identities = 44/69 (63%), Positives = 57/69 (82%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 G CSRCKRM QLL+LH+S+C+Q CRVPLCRQFKLKMQ+E++GD+ W LLV+KV A+ Sbjct: 276 GKCSRCKRMGQLLRLHSSICDQTDSCRVPLCRQFKLKMQRERRGDETLWSLLVKKVASAR 335 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 336 VMSSLSLPK 344 >ref|XP_002318693.1| predicted protein [Populus trichocarpa] Length = 364 Score = 100 bits (249), Expect = 2e-19 Identities = 44/69 (63%), Positives = 57/69 (82%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 G CSRCKRM QLL+LH+S+C+Q CRVPLCRQFKLKMQ+E++GD+ W LLV+KV A+ Sbjct: 276 GKCSRCKRMGQLLRLHSSICDQTDSCRVPLCRQFKLKMQRERRGDETLWSLLVKKVASAR 335 Query: 181 TISTLTPPK 207 +S+L+ PK Sbjct: 336 VMSSLSLPK 344 >ref|XP_004137576.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Cucumis sativus] gi|449507130|ref|XP_004162941.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Cucumis sativus] Length = 366 Score = 99.4 bits (246), Expect = 4e-19 Identities = 46/70 (65%), Positives = 57/70 (81%), Gaps = 1/70 (1%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEK-KGDDAKWRLLVRKVVLA 177 G C RCKRMWQLL+LHAS+C Q C+VPLCRQFK KM+QE + +DAKW+LLV+KV+ A Sbjct: 272 GACWRCKRMWQLLRLHASICHQSDACKVPLCRQFKQKMKQENVEKEDAKWKLLVKKVLSA 331 Query: 178 KTISTLTPPK 207 KTIS++ PK Sbjct: 332 KTISSVCLPK 341 >ref|XP_004515848.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Cicer arietinum] Length = 363 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/69 (62%), Positives = 53/69 (76%) Frame = +1 Query: 1 GGCSRCKRMWQLLKLHASVCEQLGPCRVPLCRQFKLKMQQEKKGDDAKWRLLVRKVVLAK 180 GGC RC RMWQL +LH+ VC+Q C VPLCRQF+LKM+QEK+ DD KW+LL RKV AK Sbjct: 259 GGCWRCNRMWQLFRLHSYVCQQTDSCNVPLCRQFQLKMEQEKRKDDPKWKLLARKVASAK 318 Query: 181 TISTLTPPK 207 + +L+ PK Sbjct: 319 VMFSLSLPK 327