BLASTX nr result
ID: Achyranthes22_contig00071486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00071486 (228 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADP20179.1| gag-pol polyprotein [Silene latifolia] 57 3e-06 >gb|ADP20179.1| gag-pol polyprotein [Silene latifolia] Length = 1475 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 4/67 (5%) Frame = +3 Query: 6 TKIEKLNYPTFQHPSL*AALATGW*IGGNY----KTSEGDFSSGKQYKDEVLCDVVPMDA 173 T IEKL+ PT HPS W G K FS GK Y DE LCDV+PMDA Sbjct: 416 TLIEKLSLPTQDHPS---PYKLRWLNKGAEVRVDKQCLVTFSIGKNYSDEALCDVLPMDA 472 Query: 174 CHILLGR 194 CH+LLGR Sbjct: 473 CHLLLGR 479