BLASTX nr result
ID: Achyranthes22_contig00071423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00071423 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004153003.1| PREDICTED: enzymatic polyprotein-like, parti... 48 6e-06 >ref|XP_004153003.1| PREDICTED: enzymatic polyprotein-like, partial [Cucumis sativus] Length = 1049 Score = 48.1 bits (113), Expect(2) = 6e-06 Identities = 24/61 (39%), Positives = 40/61 (65%) Frame = -2 Query: 250 EIEVEYQK*VSKLFGFDFESHYN*GTSIKLANALSREGGQLEIRTLVSACNID*DQIQKE 71 E++ ++QK ++KL G+DFE Y G K+A+ALSR+ +E+ T+ + +D + I KE Sbjct: 953 EVQPQFQKWLTKLLGYDFEILYQPGLQNKVADALSRKDHSVELNTMTTTGIVDIEIIAKE 1012 Query: 70 V 68 V Sbjct: 1013 V 1013 Score = 27.3 bits (59), Expect(2) = 6e-06 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = -1 Query: 323 KIKAKVLS--KWRHYMRGHKFLI 261 ++ A VLS KWRHY+ G KF I Sbjct: 916 ELMAVVLSVQKWRHYLLGRKFTI 938