BLASTX nr result
ID: Achyranthes22_contig00071178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00071178 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = -3 Query: 178 SLRGSHNMGKPSLSINAKIEFPKFDGSSPIIWMKKCCKYFLLFKIPNDQKVDLAYV*MM 2 S R +P L K++FPKFDGS+ W+KKCCKYF+ KIP+ QKVDLA + M+ Sbjct: 17 SPRFDERSNQPRLGYIPKLKFPKFDGSNLRQWIKKCCKYFVFCKIPDKQKVDLASLNMV 75