BLASTX nr result
ID: Achyranthes22_contig00071031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00071031 (492 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulga... 70 4e-10 ref|XP_003601488.1| hypothetical protein MTR_3g082220 [Medicago ... 56 6e-06 >emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1369 Score = 69.7 bits (169), Expect = 4e-10 Identities = 41/106 (38%), Positives = 60/106 (56%) Frame = +3 Query: 123 SRSCCFEKSMQIAYEAGITRIIVEMDRLRLDNCLRHLRKENNGFGCLVNDNLDLAKKISY 302 + +C +++AYEAG ++VEMD +L LR + FG +V+D L LA K S Sbjct: 1262 AEACSLRYGLKVAYEAGFRNLVVEMDCKKLFLQLRGKASDVTPFGRVVDDILYLASKCSN 1321 Query: 303 CVFSHVRRGGNSVVAHNLAKLSRSFSGLRVWVEEFSHETLPCVVSD 440 VF HV+R N VAH LA++ ++ RVW+EE+ E V+ D Sbjct: 1322 VVFEHVKRHCNK-VAHLLAQMCKNAMEKRVWLEEYPSEVSSAVLLD 1366 >ref|XP_003601488.1| hypothetical protein MTR_3g082220 [Medicago truncatula] gi|355490536|gb|AES71739.1| hypothetical protein MTR_3g082220 [Medicago truncatula] Length = 191 Score = 55.8 bits (133), Expect = 6e-06 Identities = 36/97 (37%), Positives = 54/97 (55%) Frame = +3 Query: 147 SMQIAYEAGITRIIVEMDRLRLDNCLRHLRKENNGFGCLVNDNLDLAKKISYCVFSHVRR 326 ++Q AY+ G IIVE D L + L+ +N+ FG +++D L+ S + SH+RR Sbjct: 92 AIQFAYDMGFRNIIVEGDYLNVVKALKPHSDDNSYFGLVIDDCRSLSCLFSSFLVSHMRR 151 Query: 327 GGNSVVAHNLAKLSRSFSGLRVWVEEFSHETLPCVVS 437 GNSV+ H L K + S + VW+E ET C+ S Sbjct: 152 VGNSVI-HALTKFALD-SSVSVWIE----ETPSCIAS 182