BLASTX nr result
ID: Achyranthes22_contig00070922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00070922 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300857.1| NO POLLEN GERMINATION 1 family protein [Popu... 61 2e-07 ref|XP_002514581.1| o-linked n-acetylglucosamine transferase, og... 60 4e-07 >ref|XP_002300857.1| NO POLLEN GERMINATION 1 family protein [Populus trichocarpa] gi|222842583|gb|EEE80130.1| NO POLLEN GERMINATION 1 family protein [Populus trichocarpa] Length = 686 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = -2 Query: 150 MAGSNSPVSSDHEEETGEREFRANGNSMKTAEVEAKLDEGNIQEAESS 7 M S S SS++E++T RE ANG MKT+EVEAKLDEGNIQEAESS Sbjct: 1 MVRSQSADSSEYEDQTPSREVWANGICMKTSEVEAKLDEGNIQEAESS 48 >ref|XP_002514581.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223546185|gb|EEF47687.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Length = 701 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/48 (66%), Positives = 35/48 (72%) Frame = -2 Query: 150 MAGSNSPVSSDHEEETGEREFRANGNSMKTAEVEAKLDEGNIQEAESS 7 M GS S ++EE+T RE ANG MKT EVEAKLDEGNIQEAESS Sbjct: 1 MVGSQSEEFGEYEEQTLVREVCANGICMKTTEVEAKLDEGNIQEAESS 48