BLASTX nr result
ID: Achyranthes22_contig00070814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00070814 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulga... 61 1e-07 >emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1378 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 8/53 (15%) Frame = +2 Query: 2 ETHIS--------DKI*FSNCLRVEAQGFSGGIWLLWNGEQVTVTPFDSNTQH 136 ETHIS D+I FS RVEA+GF GGIWL W E+VTVTP+ S++QH Sbjct: 36 ETHISGDQAQRICDRIGFSGQTRVEAEGFRGGIWLFWKSEEVTVTPYGSHSQH 88