BLASTX nr result
ID: Achyranthes22_contig00070728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00070728 (406 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ25320.1| hypothetical protein PRUPE_ppa015796mg [Prunus pe... 55 1e-05 >gb|EMJ25320.1| hypothetical protein PRUPE_ppa015796mg [Prunus persica] Length = 166 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Frame = +1 Query: 232 VSVSEVNMVMKWLGMCNQFDENQINYFEK---ENFEGLFAEEEPCLEEIWEVFKVFDENK 402 +S EV+MVM LGMCN+ + N E+ E LF EEEP LEE+ E F VFDEN+ Sbjct: 51 LSREEVDMVMGRLGMCNEHEAEGDNIGERVGAEELWRLFDEEEPSLEEVKEAFDVFDENR 110 Query: 403 D 405 D Sbjct: 111 D 111