BLASTX nr result
ID: Achyranthes22_contig00070442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00070442 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67230.1| hypothetical protein L484_025708 [Morus notabilis] 56 4e-06 ref|XP_002327517.1| predicted protein [Populus trichocarpa] gi|5... 55 1e-05 >gb|EXB67230.1| hypothetical protein L484_025708 [Morus notabilis] Length = 201 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 290 HFNHEFLQSIGITIAKHRLEILKLAKEQKSSHGFNLKQPMA 168 +FNHEFLQS+GI+IAKHRLEILKLA+++K S G +PMA Sbjct: 36 YFNHEFLQSMGISIAKHRLEILKLARKEKGSSGRG-PRPMA 75 >ref|XP_002327517.1| predicted protein [Populus trichocarpa] gi|566160447|ref|XP_006385274.1| hypothetical protein POPTR_0003s02350g [Populus trichocarpa] gi|550342214|gb|ERP63071.1| hypothetical protein POPTR_0003s02350g [Populus trichocarpa] Length = 194 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/74 (40%), Positives = 43/74 (58%) Frame = -2 Query: 293 SHFNHEFLQSIGITIAKHRLEILKLAKEQKSSHGFNLKQPMAXXXXXXXXXXXXXXXXLA 114 ++FNHEFLQS+G++IAKHRLEILKLA+++K S + MA + Sbjct: 35 AYFNHEFLQSMGVSIAKHRLEILKLARKEKGSS----SRAMARVLVAIKRTKRSLAKYVR 90 Query: 113 NLIHGENSRALIVP 72 +H E S ++VP Sbjct: 91 TWVHREESALVLVP 104