BLASTX nr result
ID: Achyranthes22_contig00070283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00070283 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280276.2| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 >ref|XP_002280276.2| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 684 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/86 (41%), Positives = 45/86 (52%), Gaps = 3/86 (3%) Frame = -3 Query: 250 SIETPFNYHPLNSTN---FSHLLKQRPALSQLQQIHAQIITQSLSSNPXXXXXXXXXXXX 80 SI P N P++ N FS LL QRP LS LQQIHAQ++TQ+LSSN Sbjct: 59 SISIPTNPIPIDLPNPQTFSLLLNQRPKLSPLQQIHAQVVTQALSSNASLTASLIHCYLC 118 Query: 79 XXXXXXXXXLFENYPLYPPPTLVWNL 2 LF++YP PP +WN+ Sbjct: 119 AKNHPNARILFDHYPSPSPPIKLWNV 144