BLASTX nr result
ID: Achyranthes22_contig00069493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00069493 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/90 (36%), Positives = 53/90 (58%), Gaps = 13/90 (14%) Frame = -2 Query: 264 TSYLFVKNNVGWDEFVADLYAKFRDESYGSEVERFNNLEQNSSLEVYIDDFDLCLNKLAS 85 +SYL + V W++FV D+ ++F+DES + VE FN L+Q +SLE YID+F+ K+ S Sbjct: 83 SSYLINRTAVDWNDFVIDVNSRFKDESGINVVEEFNKLQQTNSLEDYIDEFE----KVKS 138 Query: 84 SWKRSTF-------------WLKAAVKPFV 34 S ++++ LK ++PFV Sbjct: 139 SMLQNSYVLPEKHLMESFVGGLKPGIRPFV 168