BLASTX nr result
ID: Achyranthes22_contig00069390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00069390 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604716.1| Phytosulfokine receptor [Medicago truncatula... 58 1e-06 >ref|XP_003604716.1| Phytosulfokine receptor [Medicago truncatula] gi|358345699|ref|XP_003636913.1| Phytosulfokine receptor [Medicago truncatula] gi|355502848|gb|AES84051.1| Phytosulfokine receptor [Medicago truncatula] gi|355505771|gb|AES86913.1| Phytosulfokine receptor [Medicago truncatula] Length = 241 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 4/60 (6%) Frame = +2 Query: 125 GCVESERLGLLEIKSYLNSFADASNK--LNWSDNRGRFNCCAWDEVGCD--PSGRVTGLN 292 GCVE+ER+GLLEIK Y+ S + NK +W D+R NCC+W V C SG +T L+ Sbjct: 26 GCVENERMGLLEIKKYIVSQVEYYNKELSSWVDDRDHSNCCSWKRVKCSNFSSGHITKLS 85