BLASTX nr result
ID: Achyranthes22_contig00069365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00069365 (261 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC60545.2| sucrose-phosphate synthase [Spinacia oleracea] 62 6e-08 sp|P31928.1|SPS_SPIOL RecName: Full=Sucrose-phosphate synthase; ... 60 2e-07 >gb|AAC60545.2| sucrose-phosphate synthase [Spinacia oleracea] Length = 1056 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +3 Query: 6 RNHPLEHVMPVDNPNMFQTGGSNLDHIKEALNKLGITKS*K 128 R +P+EHVMPVD+PNMFQTGG N++HI +AL+K+G K+ K Sbjct: 1014 RAYPMEHVMPVDSPNMFQTGGCNIEHISDALSKIGCLKAQK 1054 >sp|P31928.1|SPS_SPIOL RecName: Full=Sucrose-phosphate synthase; AltName: Full=UDP-glucose-fructose-phosphate glucosyltransferase gi|170147|gb|AAA20092.1| sucrose phosphate synthase [Spinacia oleracea] Length = 1056 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 6 RNHPLEHVMPVDNPNMFQTGGSNLDHIKEALNKLGITKS*K 128 R +P+EHVMPVD+PNMFQTGG N+D I +AL+K+G K+ K Sbjct: 1014 RAYPMEHVMPVDSPNMFQTGGCNIDDISDALSKIGCLKAQK 1054