BLASTX nr result
ID: Achyranthes22_contig00069002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00069002 (235 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006436896.1| hypothetical protein CICLE_v10033094mg [Citr... 57 3e-06 gb|EOY22572.1| Ubiquitin family protein isoform 1 [Theobroma cac... 57 3e-06 gb|EOY22570.1| Ubiquitin family protein [Theobroma cacao] 57 3e-06 >ref|XP_006436896.1| hypothetical protein CICLE_v10033094mg [Citrus clementina] gi|567888750|ref|XP_006436897.1| hypothetical protein CICLE_v10033094mg [Citrus clementina] gi|568880702|ref|XP_006493249.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Citrus sinensis] gi|557539092|gb|ESR50136.1| hypothetical protein CICLE_v10033094mg [Citrus clementina] gi|557539093|gb|ESR50137.1| hypothetical protein CICLE_v10033094mg [Citrus clementina] Length = 118 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +2 Query: 71 EEELVDIVFRLHNESDIWPLCYTLASPIEMLKEHIVSEWP*GISTSIPFAIRE 229 +EEL+DI FRL++ SDI P Y+ AS ++MLK+ IVS+WP G T +P A+ E Sbjct: 3 DEELIDIKFRLYDGSDIGPFRYSSASTVDMLKQRIVSDWPKG-KTIVPKAVTE 54 >gb|EOY22572.1| Ubiquitin family protein isoform 1 [Theobroma cacao] gi|508775317|gb|EOY22573.1| Ubiquitin family protein isoform 1 [Theobroma cacao] Length = 118 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +2 Query: 71 EEELVDIVFRLHNESDIWPLCYTLASPIEMLKEHIVSEWP*GISTSIPFAIRE 229 EE+LVDI FRL++ SDI P Y+ S ++MLK+ IVS+WP G T IP A+ E Sbjct: 3 EEDLVDIKFRLYDGSDIGPFRYSATSTVDMLKQRIVSDWPKG-KTIIPKAVNE 54 >gb|EOY22570.1| Ubiquitin family protein [Theobroma cacao] Length = 118 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +2 Query: 71 EEELVDIVFRLHNESDIWPLCYTLASPIEMLKEHIVSEWP*GISTSIPFAIRE 229 EE+LVDI FRL++ SDI P Y+ S ++MLK+ IVS+WP G T IP A+ E Sbjct: 3 EEDLVDIKFRLYDGSDIGPFRYSATSTVDMLKQRIVSDWPKG-KTIIPKAVNE 54