BLASTX nr result
ID: Achyranthes22_contig00068886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00068886 (252 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 77 6e-14 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 77.0 bits (188), Expect(2) = 6e-14 Identities = 37/64 (57%), Positives = 45/64 (70%) Frame = +2 Query: 2 RLWVRKCNKYFSLYKILDNQKVDLRSLNMMGSAEKCVSSYLAVRNHVSWDEFVYDMYARF 181 R W++KC KYF KI D QKVDL SLNM+ AE VSSYL R V W++FV D+ +RF Sbjct: 46 RQWIKKCCKYFVFCKIPDKQKVDLASLNMVDKAENWVSSYLINRTAVDWNDFVIDVNSRF 105 Query: 182 RDES 193 +DES Sbjct: 106 KDES 109 Score = 25.8 bits (55), Expect(2) = 6e-14 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 204 VEKFNKLEQKGSLEAY 251 VE+FNKL+Q SLE Y Sbjct: 114 VEEFNKLQQTNSLEDY 129