BLASTX nr result
ID: Achyranthes22_contig00068619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00068619 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006425592.1| hypothetical protein CICLE_v10026781mg [Citr... 69 8e-10 ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citr... 69 8e-10 ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria... 68 1e-09 gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] 67 2e-09 gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus pe... 67 2e-09 sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Shor... 66 5e-09 ref|XP_004232447.1| PREDICTED: thioredoxin H-type 2-like [Solanu... 65 7e-09 ref|XP_004158908.1| PREDICTED: thioredoxin H-type-like [Cucumis ... 65 7e-09 ref|XP_004149979.1| PREDICTED: thioredoxin H-type-like [Cucumis ... 65 7e-09 ref|NP_001275313.1| thioredoxin H-type 2-like [Solanum tuberosum... 65 7e-09 gb|AEC03322.1| thioredoxin H-type 7 [Hevea brasiliensis] 64 2e-08 ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|111... 64 2e-08 gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] 64 3e-08 ref|XP_002310830.2| thioredoxin h family protein [Populus tricho... 64 3e-08 gb|AFK33858.1| unknown [Lotus japonicus] 63 5e-08 ref|NP_001236031.1| uncharacterized protein LOC100306506 [Glycin... 62 6e-08 gb|AEC03323.1| thioredoxin H-type 8 [Hevea brasiliensis] 62 8e-08 ref|XP_004512082.1| PREDICTED: thioredoxin H-type-like [Cicer ar... 62 1e-07 gb|AEC03320.1| thioredoxin H-type 5 [Hevea brasiliensis] 61 1e-07 gb|EXC35509.1| Thioredoxin H-type [Morus notabilis] 61 2e-07 >ref|XP_006425592.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|557527582|gb|ESR38832.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] Length = 120 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKIVD +VG+KKEELQQ IAKHL +ASA Sbjct: 80 AVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA 120 >ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|568824998|ref|XP_006466877.1| PREDICTED: thioredoxin H-type-like [Citrus sinensis] gi|119367477|gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] gi|557527581|gb|ESR38831.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] Length = 119 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKIVD +VG+KKEELQQ IAKHL +ASA Sbjct: 79 AVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA 119 >ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca] Length = 118 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKIVD +VGAKKEELQQ +AKH+ +ASA Sbjct: 78 AVEAMPTFMFLKEGKIVDKVVGAKKEELQQTVAKHVATASA 118 >gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] Length = 118 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKIVD +VGAKK++LQQ +AKH+ SASA Sbjct: 78 AVEAMPTFMFLKEGKIVDKVVGAKKDDLQQTVAKHMASASA 118 >gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica] Length = 120 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKIVD +VGAKK+ELQQ IAKH+ +ASA Sbjct: 78 AVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHVAAASA 118 >sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Short=Trx-H2 gi|297519|emb|CAA77847.1| THIOREDOXIN [Nicotiana tabacum] gi|447151|prf||1913431A thioredoxin Length = 118 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSAS 142 A+EAMPTF FLKEGKIVD +VGAKK+ELQQ IAKH+ S S Sbjct: 77 AVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHISSTS 116 >ref|XP_004232447.1| PREDICTED: thioredoxin H-type 2-like [Solanum lycopersicum] Length = 118 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF F+KEGKIVD +VGAKK+ELQQ IAKH+ S S+ Sbjct: 77 AVEAMPTFMFIKEGKIVDKVVGAKKDELQQTIAKHISSTSS 117 >ref|XP_004158908.1| PREDICTED: thioredoxin H-type-like [Cucumis sativus] Length = 90 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +2 Query: 26 IEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 +EAMPTF FLKEG+I+D +VGAKKEELQQ +AKHL +ASA Sbjct: 51 VEAMPTFMFLKEGRILDKVVGAKKEELQQTVAKHLATASA 90 >ref|XP_004149979.1| PREDICTED: thioredoxin H-type-like [Cucumis sativus] Length = 122 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +2 Query: 26 IEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 +EAMPTF FLKEG+I+D +VGAKKEELQQ +AKHL +ASA Sbjct: 83 VEAMPTFMFLKEGRILDKVVGAKKEELQQTVAKHLATASA 122 >ref|NP_001275313.1| thioredoxin H-type 2-like [Solanum tuberosum] gi|418730025|gb|AFX66981.1| thioredoxin H-type 2 [Solanum tuberosum] Length = 118 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF F+KEGKIVD +VGAKK+ELQQ IAKH+ S S+ Sbjct: 77 AVEAMPTFMFIKEGKIVDKVVGAKKDELQQTIAKHISSTSS 117 >gb|AEC03322.1| thioredoxin H-type 7 [Hevea brasiliensis] Length = 118 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKI+D +VGAKKEELQQ IAKH+ +A Sbjct: 77 AVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKHVTEVAA 117 >ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|11135282|sp|Q43636.1|TRXH_RICCO RecName: Full=Thioredoxin H-type; Short=Trx-H gi|1255954|emb|CAA94534.1| thioredoxin [Ricinus communis] gi|223525803|gb|EEF28248.1| Thioredoxin H-type [Ricinus communis] Length = 118 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSAS 142 A+E+MPTF FLKEGKI+D +VGAKK+ELQQ IAKH+ +AS Sbjct: 78 AVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKHMATAS 117 >gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] Length = 118 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKI+D +VGAKKEELQQ IAKH +A Sbjct: 77 AVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKHATEVAA 117 >ref|XP_002310830.2| thioredoxin h family protein [Populus trichocarpa] gi|118481453|gb|ABK92669.1| unknown [Populus trichocarpa] gi|550334812|gb|EEE91280.2| thioredoxin h family protein [Populus trichocarpa] Length = 122 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKIVD +VGA+K+ELQQ IAKH A+A Sbjct: 78 AVEAMPTFMFLKEGKIVDKVVGARKDELQQAIAKHTAPAAA 118 >gb|AFK33858.1| unknown [Lotus japonicus] Length = 121 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF F+KEG IVD +VGAKKEELQQ I KH+ +ASA Sbjct: 81 AVEAMPTFMFVKEGSIVDKVVGAKKEELQQKIEKHVATASA 121 >ref|NP_001236031.1| uncharacterized protein LOC100306506 [Glycine max] gi|255628731|gb|ACU14710.1| unknown [Glycine max] Length = 119 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 +IEAMPTF FLK+GKIVD +VGAKKEELQ IAKH+ +A+A Sbjct: 77 SIEAMPTFLFLKDGKIVDKVVGAKKEELQLTIAKHVSAAAA 117 >gb|AEC03323.1| thioredoxin H-type 8 [Hevea brasiliensis] Length = 118 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A++AMPTF FLKEGKI+D +VGAKKEELQQ IAKH +A Sbjct: 77 AVKAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKHATEVAA 117 >ref|XP_004512082.1| PREDICTED: thioredoxin H-type-like [Cicer arietinum] Length = 120 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF F+KEG I+D +VGAKKEELQQ I KH+ SA+A Sbjct: 80 AVEAMPTFVFVKEGTILDKVVGAKKEELQQTIEKHVASANA 120 >gb|AEC03320.1| thioredoxin H-type 5 [Hevea brasiliensis] Length = 117 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEGKIVD +VGAKKEEL+ IAKH A+A Sbjct: 77 AVEAMPTFMFLKEGKIVDKVVGAKKEELELTIAKHAQMAAA 117 >gb|EXC35509.1| Thioredoxin H-type [Morus notabilis] Length = 119 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +2 Query: 23 AIEAMPTFKFLKEGKIVDSMVGAKKEELQQIIAKHLGSASA 145 A+EAMPTF FLKEG IVD +VGA++EELQQ IAKH S+++ Sbjct: 78 AVEAMPTFMFLKEGTIVDKVVGARREELQQTIAKHTASSAS 118