BLASTX nr result
ID: Achyranthes22_contig00068590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00068590 (239 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ21834.1| hypothetical protein PRUPE_ppa002525mg [Prunus pe... 74 3e-11 ref|XP_006435788.1| hypothetical protein CICLE_v10030902mg [Citr... 72 8e-11 ref|XP_006435787.1| hypothetical protein CICLE_v10030902mg [Citr... 72 8e-11 gb|EOY34564.1| Leucine-rich repeat protein kinase family protein... 72 8e-11 ref|XP_002313236.2| hypothetical protein POPTR_0009s07920g [Popu... 72 1e-10 ref|XP_002299998.2| hypothetical protein POPTR_0001s28710g [Popu... 71 1e-10 gb|AAO59488.1| ser-thr protein kinase [Gossypium hirsutum] 71 1e-10 ref|XP_003552942.1| PREDICTED: probable LRR receptor-like serine... 71 2e-10 emb|CBI25442.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002273218.1| PREDICTED: probable LRR receptor-like serine... 70 2e-10 gb|EMJ06182.1| hypothetical protein PRUPE_ppa003329mg [Prunus pe... 70 3e-10 emb|CBI15912.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_002278392.1| PREDICTED: probable LRR receptor-like serine... 70 4e-10 ref|XP_006488566.1| PREDICTED: probable LRR receptor-like serine... 69 5e-10 ref|XP_006425119.1| hypothetical protein CICLE_v10027941mg [Citr... 69 5e-10 ref|XP_006425118.1| hypothetical protein CICLE_v10027941mg [Citr... 69 5e-10 gb|EXB44554.1| putative LRR receptor-like serine/threonine-prote... 69 6e-10 ref|XP_002528330.1| receptor protein kinase, putative [Ricinus c... 69 8e-10 dbj|BAJ91375.1| predicted protein [Hordeum vulgare subsp. vulgare] 68 1e-09 gb|EXB37967.1| putative LRR receptor-like serine/threonine-prote... 68 1e-09 >gb|EMJ21834.1| hypothetical protein PRUPE_ppa002525mg [Prunus persica] Length = 662 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/46 (65%), Positives = 42/46 (91%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP++RP +R+++ARL EITG++P+GA PKLSPLWWAELE++S DG+ Sbjct: 617 DPKQRPPMREVSARLREITGISPDGATPKLSPLWWAELELLSPDGS 662 >ref|XP_006435788.1| hypothetical protein CICLE_v10030902mg [Citrus clementina] gi|568865851|ref|XP_006486282.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like [Citrus sinensis] gi|557537984|gb|ESR49028.1| hypothetical protein CICLE_v10030902mg [Citrus clementina] Length = 664 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLD 134 DP++RP +RDIAA L EITG+ P+GAIPKLSPLWWAE+E++S + Sbjct: 619 DPEKRPTMRDIAAILREITGITPDGAIPKLSPLWWAEIEILSTE 662 >ref|XP_006435787.1| hypothetical protein CICLE_v10030902mg [Citrus clementina] gi|557537983|gb|ESR49027.1| hypothetical protein CICLE_v10030902mg [Citrus clementina] Length = 592 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLD 134 DP++RP +RDIAA L EITG+ P+GAIPKLSPLWWAE+E++S + Sbjct: 547 DPEKRPTMRDIAAILREITGITPDGAIPKLSPLWWAEIEILSTE 590 >gb|EOY34564.1| Leucine-rich repeat protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|508787309|gb|EOY34565.1| Leucine-rich repeat protein kinase family protein, putative isoform 1 [Theobroma cacao] Length = 700 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP+ERP +R+IAA+L EIT M P+GA PKLSPLWWAELE++S + + Sbjct: 655 DPKERPTMREIAAKLKEITAMGPDGATPKLSPLWWAELEILSTEAS 700 >ref|XP_002313236.2| hypothetical protein POPTR_0009s07920g [Populus trichocarpa] gi|550331265|gb|EEE87191.2| hypothetical protein POPTR_0009s07920g [Populus trichocarpa] Length = 677 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP++RP +++IA++L EIT M P+GA PKLSPLWWAELE+MS +G+ Sbjct: 632 DPKQRPTMKEIASKLKEITAMEPDGATPKLSPLWWAELEIMSTEGS 677 >ref|XP_002299998.2| hypothetical protein POPTR_0001s28710g [Populus trichocarpa] gi|550348404|gb|EEE84803.2| hypothetical protein POPTR_0001s28710g [Populus trichocarpa] Length = 715 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGALMV 149 DP+ RP +++IAA+L EIT + P+GA PKLSPLWWAELE+MS +G+ V Sbjct: 664 DPKHRPTMKEIAAKLKEITSVGPDGATPKLSPLWWAELEIMSTEGSCEV 712 >gb|AAO59488.1| ser-thr protein kinase [Gossypium hirsutum] Length = 328 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLD 134 DP+ERP +R++AA+L EIT M P+GA PKLSPLWWAELE++S + Sbjct: 283 DPKERPTMREVAAKLKEITAMGPDGATPKLSPLWWAELEILSTE 326 >ref|XP_003552942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like [Glycine max] Length = 699 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGALMVYP 155 DP++RP +R++ A+L EIT M P+GA PK SPLWWAE+E+MS D +L V P Sbjct: 649 DPEKRPTMREVTAKLKEITAMGPDGATPKASPLWWAEIEIMSSDLSLDVKP 699 >emb|CBI25442.3| unnamed protein product [Vitis vinifera] Length = 670 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP++RP +RD+ AR+ EIT + P+GAIPKLSPLWWAELE++S + + Sbjct: 625 DPKQRPTMRDVTARMREITEIGPDGAIPKLSPLWWAELEILSTEAS 670 >ref|XP_002273218.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like [Vitis vinifera] Length = 654 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP++RP +RD+ AR+ EIT + P+GAIPKLSPLWWAELE++S + + Sbjct: 609 DPKQRPTMRDVTARMREITEIGPDGAIPKLSPLWWAELEILSTEAS 654 >gb|EMJ06182.1| hypothetical protein PRUPE_ppa003329mg [Prunus persica] Length = 584 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 +P++RP + +I RL EIT M P+GAIPKLSPLWWAELE+MS +G+ Sbjct: 539 EPKQRPKMTEITGRLKEITAMGPDGAIPKLSPLWWAELEIMSTEGS 584 >emb|CBI15912.3| unnamed protein product [Vitis vinifera] Length = 338 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP +RP +R++ ARL EIT M P+GA PKLSPLWWAELE+MS + + Sbjct: 293 DPSQRPTMREVTARLKEITTMGPDGATPKLSPLWWAELEIMSSEAS 338 >ref|XP_002278392.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At5g45840-like [Vitis vinifera] Length = 720 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP +RP +R++ ARL EIT M P+GA PKLSPLWWAELE+MS + + Sbjct: 675 DPSQRPTMREVTARLKEITTMGPDGATPKLSPLWWAELEIMSSEAS 720 >ref|XP_006488566.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like isoform X1 [Citrus sinensis] gi|568870762|ref|XP_006488567.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like isoform X2 [Citrus sinensis] Length = 685 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP++RP++R IAA+L EIT M P+GA PKLSPLWWAELE++S + + Sbjct: 640 DPKQRPSMRGIAAKLKEITAMEPDGATPKLSPLWWAELEILSSEAS 685 >ref|XP_006425119.1| hypothetical protein CICLE_v10027941mg [Citrus clementina] gi|557527053|gb|ESR38359.1| hypothetical protein CICLE_v10027941mg [Citrus clementina] Length = 685 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP++RP++R IAA+L EIT M P+GA PKLSPLWWAELE++S + + Sbjct: 640 DPKQRPSMRGIAAKLKEITAMEPDGATPKLSPLWWAELEILSSEAS 685 >ref|XP_006425118.1| hypothetical protein CICLE_v10027941mg [Citrus clementina] gi|567864942|ref|XP_006425120.1| hypothetical protein CICLE_v10027941mg [Citrus clementina] gi|557527052|gb|ESR38358.1| hypothetical protein CICLE_v10027941mg [Citrus clementina] gi|557527054|gb|ESR38360.1| hypothetical protein CICLE_v10027941mg [Citrus clementina] Length = 589 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 DP++RP++R IAA+L EIT M P+GA PKLSPLWWAELE++S + + Sbjct: 544 DPKQRPSMRGIAAKLKEITAMEPDGATPKLSPLWWAELEILSSEAS 589 >gb|EXB44554.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 [Morus notabilis] Length = 640 Score = 68.9 bits (167), Expect = 6e-10 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLD 134 DP++RPA+R++ RL EITG+ P+GA P+LSPLWWAELE+MS + Sbjct: 595 DPRQRPAMREVCIRLREITGITPDGASPRLSPLWWAELELMSTE 638 >ref|XP_002528330.1| receptor protein kinase, putative [Ricinus communis] gi|223532285|gb|EEF34088.1| receptor protein kinase, putative [Ricinus communis] Length = 459 Score = 68.6 bits (166), Expect = 8e-10 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLD 134 DP++RP++ ++ ARL E+TG+ P+ AIPKLSPLWWAELE++S D Sbjct: 414 DPKQRPSMGEVTARLREVTGLVPDAAIPKLSPLWWAELEILSPD 457 >dbj|BAJ91375.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 498 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMS 128 DP+ RPA+ ++AARL EIT + P+GA PK+SPLWWAELE+MS Sbjct: 453 DPKRRPAMAEVAARLKEITALGPDGATPKVSPLWWAELEIMS 494 >gb|EXB37967.1| putative LRR receptor-like serine/threonine-protein kinase MRH1 [Morus notabilis] Length = 701 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +3 Query: 3 DPQERPALRDIAARLTEITGMAPNGAIPKLSPLWWAELEVMSLDGA 140 +P++RP + +I +RL EIT M P+GA PKLSPLWWAELE+MS +G+ Sbjct: 656 NPKQRPTIAEITSRLKEITDMGPDGATPKLSPLWWAELEIMSSEGS 701