BLASTX nr result
ID: Achyranthes22_contig00068589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00068589 (270 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507... 60 8e-11 ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 60 8e-11 gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] 67 2e-09 ref|XP_002535452.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 gb|EMJ12244.1| hypothetical protein PRUPE_ppa019081mg, partial [... 55 1e-05 >ref|XP_004510058.1| PREDICTED: uncharacterized protein LOC101507236 [Cicer arietinum] Length = 614 Score = 60.5 bits (145), Expect(2) = 8e-11 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 117 PSPQAELVSRVIGDHFARFGGHLSQPPV 34 P+PQAELVSRVIGDHFARFGGHLSQPP+ Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPPI 81 Score = 31.6 bits (70), Expect(2) = 8e-11 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 160 LYSRGAPDRRRIIGTLTP 107 ++S GAPDRRRIIGT TP Sbjct: 39 VHSWGAPDRRRIIGTPTP 56 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477395|gb|AES58598.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 60.5 bits (145), Expect(2) = 8e-11 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 117 PSPQAELVSRVIGDHFARFGGHLSQPPV 34 P+PQAELVSRVIGDHFARFGGHLSQPP+ Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPPI 81 Score = 31.6 bits (70), Expect(2) = 8e-11 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 160 LYSRGAPDRRRIIGTLTP 107 ++S GAPDRRRIIGT TP Sbjct: 39 VHSWGAPDRRRIIGTPTP 56 >gb|EXB74570.1| hypothetical protein L484_026267 [Morus notabilis] Length = 169 Score = 67.4 bits (163), Expect = 2e-09 Identities = 38/53 (71%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -3 Query: 166 AALYS--RGAPDRRRIIGTLTPGRVSEPCNRRPFRAVRGALESAAGARLRLDP 14 A +YS G P R TPGRVSEPCNRRPFRAVRGALESAAGARLRL P Sbjct: 108 ACMYSGCAGPPTNNRYP---TPGRVSEPCNRRPFRAVRGALESAAGARLRLVP 157 >ref|XP_002535452.1| conserved hypothetical protein [Ricinus communis] gi|223523063|gb|EEF26931.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 1 QKWDRGQDAVGHRRLTQVPPEPREMVAYYTAH 96 QKWDRGQDAVG RRLTQVP EPREMVAYYTAH Sbjct: 24 QKWDRGQDAVGRRRLTQVPLEPREMVAYYTAH 55 >gb|EMJ12244.1| hypothetical protein PRUPE_ppa019081mg, partial [Prunus persica] Length = 84 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 96 VSRVIGDHFARFGGHLSQPPVPDCVLTPIPF 4 VSRVIG HFARFGGHLSQPP PDC+L F Sbjct: 22 VSRVIGYHFARFGGHLSQPPAPDCILAESEF 52