BLASTX nr result
ID: Achyranthes22_contig00068574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00068574 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_063999.1| orf100a gene product (mitochondrion) [Beta vulg... 40 2e-06 >ref|NP_063999.1| orf100a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435156|ref|YP_004222374.1| hypothetical protein BevumaM_p141 [Beta vulgaris subsp. maritima] gi|346683248|ref|YP_004842180.1| hypothetical protein BemaM_p136 [Beta macrocarpa] gi|9049301|dbj|BAA99311.1| orf100a [Beta vulgaris subsp. vulgaris] gi|317905607|emb|CBJ14013.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439889|emb|CBJ17589.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148044|emb|CBJ20707.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500166|emb|CBX24985.1| hypothetical protein [Beta macrocarpa] gi|384977908|emb|CBL54132.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 100 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +1 Query: 73 PN*SSRIFFYIPDFKHNLLSVSKLLRTERLVLYIDSER 186 PN + Y+ DFKHNLLSVSKLL + L L D++R Sbjct: 61 PNVTLTGVLYVNDFKHNLLSVSKLLESRNLRLLFDNQR 98 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = +3 Query: 6 IKVGLPDGTVKIVRELGDIKLMPELVI 86 I+VGLPDG+VK V E+G++K+ P + + Sbjct: 39 IRVGLPDGSVKTVNEVGNVKISPNVTL 65