BLASTX nr result
ID: Achyranthes22_contig00068537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00068537 (238 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK13839.1| calmcium/calmodulin-dependent protein kinase CDPK... 100 3e-19 gb|EMJ16465.1| hypothetical protein PRUPE_ppa004580mg [Prunus pe... 71 1e-10 ref|XP_004303728.1| PREDICTED: calcium-dependent protein kinase ... 69 6e-10 ref|XP_004303727.1| PREDICTED: calcium-dependent protein kinase ... 69 6e-10 gb|AAV28169.1| calcium-dependent protein kinase 1 [Vicia faba] 66 5e-09 ref|XP_002518006.1| calcium-dependent protein kinase, putative [... 64 2e-08 ref|XP_006340028.1| PREDICTED: calcium-dependent protein kinase ... 64 2e-08 ref|XP_006426413.1| hypothetical protein CICLE_v10025418mg [Citr... 64 2e-08 ref|XP_006426412.1| hypothetical protein CICLE_v10025418mg [Citr... 64 2e-08 ref|XP_006426411.1| hypothetical protein CICLE_v10025418mg [Citr... 64 2e-08 ref|XP_004503020.1| PREDICTED: calcium-dependent protein kinase ... 64 2e-08 ref|XP_004237548.1| PREDICTED: calcium-dependent protein kinase ... 64 2e-08 gb|AFK38450.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_003526904.1| PREDICTED: calcium-dependent protein kinase ... 63 4e-08 ref|XP_004147335.1| PREDICTED: calcium-dependent protein kinase ... 63 5e-08 ref|XP_006397184.1| hypothetical protein EUTSA_v10028598mg [Eutr... 62 1e-07 ref|XP_006287576.1| hypothetical protein CARUB_v10000785mg [Caps... 62 1e-07 ref|XP_004503860.1| PREDICTED: calcium-dependent protein kinase ... 61 1e-07 ref|XP_004496370.1| PREDICTED: calcium-dependent protein kinase ... 61 1e-07 ref|XP_002872452.1| calcium-dependent protein kinase 4 [Arabidop... 61 1e-07 >gb|AFK13839.1| calmcium/calmodulin-dependent protein kinase CDPK2 [Beta vulgaris subsp. vulgaris] Length = 493 Score = 99.8 bits (247), Expect = 3e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +1 Query: 88 MTFNKANSVRFSKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 M FNK NSVRFSKPTS+LPYETQN+NDLYTLG+KLGQGQYGTTYLCTENS Sbjct: 1 MPFNKTNSVRFSKPTSILPYETQNVNDLYTLGEKLGQGQYGTTYLCTENS 50 >gb|EMJ16465.1| hypothetical protein PRUPE_ppa004580mg [Prunus persica] Length = 502 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 121 SKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 SKPT VLPY+TQNL DLYTLG+ LGQGQ+GTTYLCTE+S Sbjct: 13 SKPTWVLPYKTQNLTDLYTLGRVLGQGQFGTTYLCTESS 51 >ref|XP_004303728.1| PREDICTED: calcium-dependent protein kinase SK5-like isoform 2 [Fragaria vesca subsp. vesca] Length = 466 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 100 KANSVRFSKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 K++S S P VLPY+TQNL DLYTLGK LGQGQ+GTTYLCT+ S Sbjct: 3 KSSSATPSNPKWVLPYQTQNLTDLYTLGKILGQGQFGTTYLCTDKS 48 >ref|XP_004303727.1| PREDICTED: calcium-dependent protein kinase SK5-like isoform 1 [Fragaria vesca subsp. vesca] Length = 498 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 100 KANSVRFSKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 K++S S P VLPY+TQNL DLYTLGK LGQGQ+GTTYLCT+ S Sbjct: 3 KSSSATPSNPKWVLPYQTQNLTDLYTLGKILGQGQFGTTYLCTDKS 48 >gb|AAV28169.1| calcium-dependent protein kinase 1 [Vicia faba] Length = 493 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 124 KPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTEN 234 KPT VLPY T+N+ +LYTLG+KLGQGQ+GTTYLCT N Sbjct: 11 KPTWVLPYITENIRELYTLGRKLGQGQFGTTYLCTHN 47 >ref|XP_002518006.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223542988|gb|EEF44524.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 305 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 121 SKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 SKP VLPY TQNL + YT+GKKLGQGQ+GTTYLCT S Sbjct: 32 SKPKWVLPYRTQNLREHYTIGKKLGQGQFGTTYLCTYKS 70 >ref|XP_006340028.1| PREDICTED: calcium-dependent protein kinase SK5-like [Solanum tuberosum] Length = 510 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +1 Query: 100 KANSVRFSKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 K ++V KPT VLPY T+ L LY++GKKLGQGQ+GTT+LCTE S Sbjct: 18 KTSTVPPLKPTWVLPYRTERLQQLYSIGKKLGQGQFGTTHLCTEKS 63 >ref|XP_006426413.1| hypothetical protein CICLE_v10025418mg [Citrus clementina] gi|557528403|gb|ESR39653.1| hypothetical protein CICLE_v10025418mg [Citrus clementina] Length = 476 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 121 SKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 +KP VLPY TQNL YT+GKKLGQGQ+GTTYLCT+ S Sbjct: 22 TKPRRVLPYSTQNLTHDYTIGKKLGQGQFGTTYLCTQKS 60 >ref|XP_006426412.1| hypothetical protein CICLE_v10025418mg [Citrus clementina] gi|557528402|gb|ESR39652.1| hypothetical protein CICLE_v10025418mg [Citrus clementina] Length = 469 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 121 SKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 +KP VLPY TQNL YT+GKKLGQGQ+GTTYLCT+ S Sbjct: 22 TKPRRVLPYSTQNLTHDYTIGKKLGQGQFGTTYLCTQKS 60 >ref|XP_006426411.1| hypothetical protein CICLE_v10025418mg [Citrus clementina] gi|568823619|ref|XP_006466209.1| PREDICTED: calcium-dependent protein kinase SK5-like [Citrus sinensis] gi|557528401|gb|ESR39651.1| hypothetical protein CICLE_v10025418mg [Citrus clementina] Length = 505 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 121 SKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 +KP VLPY TQNL YT+GKKLGQGQ+GTTYLCT+ S Sbjct: 22 TKPRRVLPYSTQNLTHDYTIGKKLGQGQFGTTYLCTQKS 60 >ref|XP_004503020.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cicer arietinum] Length = 499 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 124 KPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 KPT VLPY T+NL ++YTLG+KLGQGQ+GTTYLC N+ Sbjct: 17 KPTWVLPYVTENLREVYTLGRKLGQGQFGTTYLCRHNT 54 >ref|XP_004237548.1| PREDICTED: calcium-dependent protein kinase SK5-like [Solanum lycopersicum] Length = 508 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +1 Query: 100 KANSVRFSKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 K ++V KPT VLPY T+ L LY++GKKLGQGQ+GTT+LCTE S Sbjct: 15 KTSTVPPLKPTWVLPYRTERLQQLYSIGKKLGQGQFGTTHLCTEKS 60 >gb|AFK38450.1| unknown [Lotus japonicus] Length = 244 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 124 KPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 KPT+VLPY T+N+ ++YT G+KLGQGQ+GTTYLC NS Sbjct: 11 KPTTVLPYLTENIREVYTFGRKLGQGQFGTTYLCRHNS 48 >ref|XP_003526904.1| PREDICTED: calcium-dependent protein kinase SK5-like [Glycine max] Length = 497 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 124 KPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 KPT VLPY T+NL ++YTL +KLGQGQ+GTT+LCT N+ Sbjct: 15 KPTWVLPYRTENLREVYTLSRKLGQGQFGTTFLCTHNA 52 >ref|XP_004147335.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cucumis sativus] gi|449508715|ref|XP_004163390.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cucumis sativus] Length = 503 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 121 SKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTE 231 +KP+ VLPY TQ L D YTLGKKLGQGQ+GTT+LCT+ Sbjct: 13 AKPSWVLPYRTQPLTDFYTLGKKLGQGQFGTTFLCTD 49 >ref|XP_006397184.1| hypothetical protein EUTSA_v10028598mg [Eutrema salsugineum] gi|557098201|gb|ESQ38637.1| hypothetical protein EUTSA_v10028598mg [Eutrema salsugineum] Length = 501 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 130 TSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 +SVLPYET L D Y LGKKLGQGQ+GTTYLCTE S Sbjct: 11 SSVLPYETPRLRDHYLLGKKLGQGQFGTTYLCTEKS 46 >ref|XP_006287576.1| hypothetical protein CARUB_v10000785mg [Capsella rubella] gi|482556282|gb|EOA20474.1| hypothetical protein CARUB_v10000785mg [Capsella rubella] Length = 501 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 130 TSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 +SVLPYET L D Y LGKKLGQGQ+GTTYLCTE S Sbjct: 11 SSVLPYETPRLRDHYLLGKKLGQGQFGTTYLCTEKS 46 >ref|XP_004503860.1| PREDICTED: calcium-dependent protein kinase SK5-like [Cicer arietinum] Length = 497 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = +1 Query: 97 NKANSVRFSKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 N N++ T VLPY TQ + ++YT+G+KLGQGQ+GTTYLCT + Sbjct: 5 NNPNTLTLKPVTWVLPYRTQKITEIYTIGRKLGQGQFGTTYLCTHKT 51 >ref|XP_004496370.1| PREDICTED: calcium-dependent protein kinase 4-like [Cicer arietinum] Length = 497 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 121 SKPTSVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 SK T+VLPY+T L D Y LGKKLGQGQ+GTTYLCT S Sbjct: 12 SKCTAVLPYQTPRLRDHYLLGKKLGQGQFGTTYLCTHKS 50 >ref|XP_002872452.1| calcium-dependent protein kinase 4 [Arabidopsis lyrata subsp. lyrata] gi|297318289|gb|EFH48711.1| calcium-dependent protein kinase 4 [Arabidopsis lyrata subsp. lyrata] Length = 501 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +1 Query: 133 SVLPYETQNLNDLYTLGKKLGQGQYGTTYLCTENS 237 SVLPYET L D Y LGKKLGQGQ+GTTYLCTE S Sbjct: 12 SVLPYETPRLRDHYLLGKKLGQGQFGTTYLCTEKS 46