BLASTX nr result
ID: Achyranthes22_contig00068383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00068383 (228 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78957.1| hypothetical protein (mitochondrion) [Vicia faba] 74 3e-16 ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, part... 77 2e-14 >gb|AGC78957.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 106 Score = 73.6 bits (179), Expect(2) = 3e-16 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +3 Query: 24 NSWLETILMVLISGRNNKNQSPGWLVSLVIGNYLARFGEHLLG 152 + W ++ LMVLISGRNN+N+SPGWLVSLVIG+YLA FGEHLLG Sbjct: 64 HGWKQSFLMVLISGRNNQNKSPGWLVSLVIGDYLAWFGEHLLG 106 Score = 37.0 bits (84), Expect(2) = 3e-16 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 QERLCHMGTHGWKQS 45 QERLC+MGTHGWKQS Sbjct: 55 QERLCNMGTHGWKQS 69 >ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] gi|557103037|gb|ESQ43400.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] Length = 251 Score = 77.4 bits (189), Expect(2) = 2e-14 Identities = 40/48 (83%), Positives = 41/48 (85%) Frame = +3 Query: 6 ALMSYGNSWLETILMVLISGRNNKNQSPGWLVSLVIGNYLARFGEHLL 149 ALMSY NSWLETILMVLISGRNNKNQSPG LVSLVIG+YLA LL Sbjct: 173 ALMSYENSWLETILMVLISGRNNKNQSPGRLVSLVIGDYLACLNAELL 220 Score = 26.9 bits (58), Expect(2) = 2e-14 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +2 Query: 182 LNAELLTLLVWMGVY 226 LNAELLTLLV MGV+ Sbjct: 215 LNAELLTLLVRMGVH 229