BLASTX nr result
ID: Achyranthes22_contig00067422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00067422 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago ... 112 7e-23 ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, part... 79 7e-19 gb|AGC78957.1| hypothetical protein (mitochondrion) [Vicia faba] 87 2e-15 gb|EXB37612.1| hypothetical protein L484_021818 [Morus notabilis] 66 5e-09 >ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago truncatula] gi|355477312|gb|AES58515.1| hypothetical protein MTR_1g005050 [Medicago truncatula] Length = 334 Score = 112 bits (279), Expect = 7e-23 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 4/87 (4%) Frame = +2 Query: 20 RRKGLRITNPVGPGS--FSLANRIPPQRH--IALYRSRSVFATAGKAAVEAKPIAPPTIK 187 RRKGLRI NPVG + F+ A I R+ +A YRSRSVFATAG+A VEAKPIA PTIK Sbjct: 204 RRKGLRIPNPVGGRTALFAPAWLIASPRNDILAPYRSRSVFATAGEAVVEAKPIATPTIK 263 Query: 188 YEIGPLL*NWMEWPTPPKSAYVIWELM 268 YEIGPLL + MEWP+PPKSAYVIWELM Sbjct: 264 YEIGPLLKDLMEWPSPPKSAYVIWELM 290 >ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] gi|557103037|gb|ESQ43400.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] Length = 251 Score = 79.0 bits (193), Expect(2) = 7e-19 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +1 Query: 103 RSLPFSLSICNGWEGSRRSEAYRPADHQIRDWAPSIKLDGMAHP 234 R LPFSLS+CNGW GSRRSE YR A+HQIRDWAPS + DGMA+P Sbjct: 128 RPLPFSLSVCNGWGGSRRSEVYRHANHQIRDWAPSQRFDGMAYP 171 Score = 40.4 bits (93), Expect(2) = 7e-19 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 219 WNGPPRPRALMSYGNSWLETILMVLIS 299 ++G P ALMSY NSWLETILMVLIS Sbjct: 165 FDGMAYPIALMSYENSWLETILMVLIS 191 >gb|AGC78957.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 106 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = +2 Query: 71 LANRIPPQRHIALYRSRSVFATAGKAAVEAKPIAPPTIKYEIGPLL*NWMEWPT 232 +ANRIP QRH A YRSRSVFATAG+A VEAKPIA PTIK EIGPLL ++MEWPT Sbjct: 1 MANRIPAQRHSAPYRSRSVFATAGEAVVEAKPIATPTIKDEIGPLLKDFMEWPT 54 >gb|EXB37612.1| hypothetical protein L484_021818 [Morus notabilis] Length = 167 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 218 MEWPTPPKSAYVIWELMAGNNPYGFDIR 301 MEWP+PPKSAYVIWELMAGNNPYGFDIR Sbjct: 11 MEWPSPPKSAYVIWELMAGNNPYGFDIR 38