BLASTX nr result
ID: Achyranthes22_contig00067401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00067401 (317 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267962.1| PREDICTED: glutaredoxin-C11 [Vitis vinifera] 68 1e-09 gb|ESW16551.1| hypothetical protein PHAVU_007G165800g [Phaseolus... 67 2e-09 gb|EOX94964.1| Thioredoxin superfamily protein [Theobroma cacao] 67 2e-09 ref|XP_006575104.1| PREDICTED: glutaredoxin-C11-like [Glycine max] 67 2e-09 ref|NP_001238068.1| uncharacterized protein LOC100305876 [Glycin... 67 2e-09 ref|XP_002520675.1| glutaredoxin, grx, putative [Ricinus communi... 67 3e-09 ref|XP_004495991.1| PREDICTED: glutaredoxin-C11-like [Cicer arie... 66 5e-09 gb|ACJ85884.1| unknown [Medicago truncatula] gi|388495706|gb|AFK... 66 5e-09 ref|XP_002320645.1| glutaredoxin [Populus trichocarpa] gi|566260... 65 9e-09 ref|XP_002320360.1| glutaredoxin family protein [Populus trichoc... 65 9e-09 ref|XP_006444243.1| hypothetical protein CICLE_v10023999mg [Citr... 65 1e-08 gb|EPS63130.1| hypothetical protein M569_11657 [Genlisea aurea] 65 1e-08 ref|XP_004494334.1| PREDICTED: glutaredoxin-C11-like [Cicer arie... 65 1e-08 ref|XP_003625872.1| Glutaredoxin [Medicago truncatula] gi|355500... 64 2e-08 ref|XP_003625871.1| Glutaredoxin [Medicago truncatula] gi|355500... 64 2e-08 ref|XP_003521537.1| PREDICTED: glutaredoxin-C11-like [Glycine ma... 64 3e-08 gb|ADV56688.1| glutaredoxin [Phaseolus vulgaris] gi|561036530|gb... 64 3e-08 gb|EXC34707.1| hypothetical protein L484_020479 [Morus notabilis] 63 4e-08 ref|XP_004136054.1| PREDICTED: glutaredoxin-C11-like [Cucumis sa... 63 4e-08 ref|XP_006359427.1| PREDICTED: glutaredoxin-C11-like [Solanum tu... 61 1e-07 >ref|XP_002267962.1| PREDICTED: glutaredoxin-C11 [Vitis vinifera] Length = 102 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVF+GG FVGSAKDV+ +H+ GSLK MLIAA+AIWF Sbjct: 63 PSVPAVFVGGKFVGSAKDVITSHVDGSLKQMLIAARAIWF 102 >gb|ESW16551.1| hypothetical protein PHAVU_007G165800g [Phaseolus vulgaris] Length = 156 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK ML+AAKAIWF Sbjct: 117 PSVPAVFIGGKFVGSSKDVISLHVDGSLKQMLMAAKAIWF 156 >gb|EOX94964.1| Thioredoxin superfamily protein [Theobroma cacao] Length = 102 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGSAKDV++ H+ GSLK MLI AKAIWF Sbjct: 63 PSVPAVFIGGRFVGSAKDVISLHVDGSLKQMLIDAKAIWF 102 >ref|XP_006575104.1| PREDICTED: glutaredoxin-C11-like [Glycine max] Length = 102 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK ML+AAKAIWF Sbjct: 63 PSVPAVFIGGKFVGSSKDVISLHVDGSLKQMLMAAKAIWF 102 >ref|NP_001238068.1| uncharacterized protein LOC100305876 [Glycine max] gi|255626861|gb|ACU13775.1| unknown [Glycine max] Length = 102 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK ML+AAKAIWF Sbjct: 63 PSVPAVFIGGKFVGSSKDVISLHVDGSLKQMLMAAKAIWF 102 >ref|XP_002520675.1| glutaredoxin, grx, putative [Ricinus communis] gi|223540060|gb|EEF41637.1| glutaredoxin, grx, putative [Ricinus communis] Length = 102 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG +VGSAKDVL+ HL GSLK MLI A+AIWF Sbjct: 63 PSVPAVFIGGKYVGSAKDVLSLHLDGSLKQMLIDARAIWF 102 >ref|XP_004495991.1| PREDICTED: glutaredoxin-C11-like [Cicer arietinum] Length = 102 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK ML+AA+AIWF Sbjct: 63 PSVPAVFIGGKFVGSSKDVISLHVDGSLKQMLMAARAIWF 102 >gb|ACJ85884.1| unknown [Medicago truncatula] gi|388495706|gb|AFK35919.1| unknown [Medicago truncatula] Length = 102 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK ML+AA+AIWF Sbjct: 63 PSVPAVFIGGKFVGSSKDVISLHVDGSLKQMLMAARAIWF 102 >ref|XP_002320645.1| glutaredoxin [Populus trichocarpa] gi|566260250|ref|XP_006389678.1| glutaredoxin family protein [Populus trichocarpa] gi|550312560|gb|ERP48592.1| glutaredoxin family protein [Populus trichocarpa] Length = 102 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 P+VPAVFIGG +VGSAKDVL+ HL GSLK ML+ AKAIWF Sbjct: 63 PTVPAVFIGGKWVGSAKDVLSLHLDGSLKQMLMEAKAIWF 102 >ref|XP_002320360.1| glutaredoxin family protein [Populus trichocarpa] gi|222861133|gb|EEE98675.1| glutaredoxin family protein [Populus trichocarpa] Length = 102 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 P+VPAVFIGG +VGSAKDVL+ HL GSLK ML+ AKAIWF Sbjct: 63 PTVPAVFIGGKWVGSAKDVLSLHLDGSLKQMLMEAKAIWF 102 >ref|XP_006444243.1| hypothetical protein CICLE_v10023999mg [Citrus clementina] gi|568852438|ref|XP_006479883.1| PREDICTED: glutaredoxin-C11-like [Citrus sinensis] gi|557546505|gb|ESR57483.1| hypothetical protein CICLE_v10023999mg [Citrus clementina] Length = 102 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG +VGSAKDV++ H+ GSLK MLI A+AIWF Sbjct: 63 PSVPAVFIGGRYVGSAKDVISLHVDGSLKQMLIDARAIWF 102 >gb|EPS63130.1| hypothetical protein M569_11657 [Genlisea aurea] Length = 102 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG F+GSAKDV++ H+ GSLK+ LI AKAIWF Sbjct: 63 PSVPAVFIGGEFIGSAKDVISLHVDGSLKERLINAKAIWF 102 >ref|XP_004494334.1| PREDICTED: glutaredoxin-C11-like [Cicer arietinum] Length = 103 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK ML+ AKAIWF Sbjct: 64 PSVPAVFIGGKFVGSSKDVISLHVDGSLKQMLMDAKAIWF 103 >ref|XP_003625872.1| Glutaredoxin [Medicago truncatula] gi|355500887|gb|AES82090.1| Glutaredoxin [Medicago truncatula] Length = 103 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK ML+ AKAIWF Sbjct: 64 PSVPAVFIGGKFVGSSKDVISHHVDGSLKQMLMDAKAIWF 103 >ref|XP_003625871.1| Glutaredoxin [Medicago truncatula] gi|355500886|gb|AES82089.1| Glutaredoxin [Medicago truncatula] Length = 103 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK ML+ AKAIWF Sbjct: 64 PSVPAVFIGGKFVGSSKDVISHHVDGSLKQMLMDAKAIWF 103 >ref|XP_003521537.1| PREDICTED: glutaredoxin-C11-like [Glycine max] gi|571559359|ref|XP_006604701.1| PREDICTED: glutaredoxin-C11-like [Glycine max] Length = 102 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK +L+ AKAIWF Sbjct: 63 PSVPAVFIGGKFVGSSKDVISLHVDGSLKQLLMDAKAIWF 102 >gb|ADV56688.1| glutaredoxin [Phaseolus vulgaris] gi|561036530|gb|ESW35060.1| hypothetical protein PHAVU_001G203300g [Phaseolus vulgaris] Length = 102 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 PSVPAVFIGG FVGS+KDV++ H+ GSLK +L+ AKAIWF Sbjct: 63 PSVPAVFIGGKFVGSSKDVISLHVDGSLKQLLMDAKAIWF 102 >gb|EXC34707.1| hypothetical protein L484_020479 [Morus notabilis] Length = 103 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIWF 121 P+VPAVFIGG FVGSAKD+++ H+ G+LK MLI A+AIWF Sbjct: 64 PAVPAVFIGGKFVGSAKDIISLHVDGTLKQMLIDARAIWF 103 >ref|XP_004136054.1| PREDICTED: glutaredoxin-C11-like [Cucumis sativus] gi|449520869|ref|XP_004167455.1| PREDICTED: glutaredoxin-C11-like [Cucumis sativus] Length = 102 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIW 118 PSVPAVFIGG F+GSAKDV++ H+ G LK MLI AKAIW Sbjct: 63 PSVPAVFIGGKFIGSAKDVISLHVNGDLKQMLIDAKAIW 101 >ref|XP_006359427.1| PREDICTED: glutaredoxin-C11-like [Solanum tuberosum] Length = 102 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 PSVPAVFIGGCFVGSAKDVLAAHLTGSLKDMLIAAKAIW 118 P VPA+FIGG FVGS KDV++ H+ GSLK MLI AKAIW Sbjct: 63 PCVPAIFIGGHFVGSTKDVISLHVNGSLKQMLINAKAIW 101