BLASTX nr result
ID: Achyranthes22_contig00067154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00067154 (468 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEV42258.1| hypothetical protein [Beta vulgaris] 55 2e-06 >gb|AEV42258.1| hypothetical protein [Beta vulgaris] Length = 1553 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 13/73 (17%) Frame = -3 Query: 346 LSALSVQPMFFEEIWSTKVKTRN*RRLKVR-------------S*SIRFKGKWCVPEGCA 206 LSAL+++P F EEI +++ R+K + SIR+KG+WCVP+ C Sbjct: 1038 LSALTIEPNFLEEIRASQPGDVKLERVKAKLKEGKAEGFAIHEDGSIRYKGRWCVPQKCE 1097 Query: 205 ELKERIMKQSHKT 167 ELK++IM + H T Sbjct: 1098 ELKQKIMSEGHNT 1110 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 147 GDKMYQDMR*FLW*VGIE 94 GDK+Y+D++ W G++ Sbjct: 1118 GDKLYKDLKKMFWWPGMK 1135