BLASTX nr result
ID: Achyranthes22_contig00065862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00065862 (208 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20053.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002269015.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 emb|CAN60904.1| hypothetical protein VITISV_016343 [Vitis vinifera] 71 1e-10 ref|XP_004168722.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_004137128.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006409538.1| hypothetical protein EUTSA_v10022592mg [Eutr... 62 6e-08 gb|EXC05161.1| hypothetical protein L484_003967 [Morus notabilis] 62 8e-08 gb|EOX97196.1| Pentatricopeptide repeat superfamily protein isof... 59 7e-07 gb|EOX97191.1| Pentatricopeptide repeat (PPR) superfamily protei... 59 7e-07 gb|EMJ02723.1| hypothetical protein PRUPE_ppa015625mg, partial [... 58 1e-06 ref|XP_002519129.1| pentatricopeptide repeat-containing protein,... 58 1e-06 gb|ESW33628.1| hypothetical protein PHAVU_001G085800g [Phaseolus... 57 2e-06 ref|XP_003540687.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|NP_179165.1| pentatricopeptide repeat-containing protein [Ar... 55 7e-06 ref|XP_002330266.1| predicted protein [Populus trichocarpa] 55 1e-05 >emb|CBI20053.3| unnamed protein product [Vitis vinifera] Length = 634 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/68 (50%), Positives = 49/68 (72%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFI+Q++ LTP +IS+ L NL SKP LVS F+ + LD ++ +A+V+++ PS Sbjct: 60 QWHFIEQVSPNLTPALISNVLYNLCSKPQLVSDFIHHLHPHCLDTKSYCLAVVLLARLPS 119 Query: 183 PKLALQLV 206 PKLALQL+ Sbjct: 120 PKLALQLL 127 >ref|XP_002269015.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Vitis vinifera] Length = 656 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/68 (50%), Positives = 49/68 (72%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFI+Q++ LTP +IS+ L NL SKP LVS F+ + LD ++ +A+V+++ PS Sbjct: 82 QWHFIEQVSPNLTPALISNVLYNLCSKPQLVSDFIHHLHPHCLDTKSYCLAVVLLARLPS 141 Query: 183 PKLALQLV 206 PKLALQL+ Sbjct: 142 PKLALQLL 149 >emb|CAN60904.1| hypothetical protein VITISV_016343 [Vitis vinifera] Length = 580 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/68 (50%), Positives = 49/68 (72%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFI+Q++ LTP +IS+ L NL SKP LVS F+ + LD ++ +A+V+++ PS Sbjct: 82 QWHFIEQVSPNLTPALISNVLYNLCSKPQLVSDFIHHLHPHCLDTKSYCLAVVLLARLPS 141 Query: 183 PKLALQLV 206 PKLALQL+ Sbjct: 142 PKLALQLL 149 >ref|XP_004168722.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Cucumis sativus] Length = 628 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/68 (48%), Positives = 44/68 (64%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFIKQ+ S+LTP++IS TLLNL P +V FL + D +A+VI++ PS Sbjct: 53 QWHFIKQVESSLTPSLISQTLLNLHESPQVVLDFLNHFHHKLSDARTLCLAIVIVARLPS 112 Query: 183 PKLALQLV 206 PK AL L+ Sbjct: 113 PKPALHLL 120 >ref|XP_004137128.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Cucumis sativus] Length = 628 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/68 (48%), Positives = 44/68 (64%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFIKQ+ S+LTP++IS TLLNL P +V FL + D +A+VI++ PS Sbjct: 53 QWHFIKQVESSLTPSLISQTLLNLHESPQVVLDFLNHFHHKLSDARTLCLAIVIVARLPS 112 Query: 183 PKLALQLV 206 PK AL L+ Sbjct: 113 PKPALHLL 120 >ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum tuberosum] Length = 618 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/68 (47%), Positives = 42/68 (61%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFIK + L PT+IS TL +LRS P V F+E + LDI + +A+ I+S PS Sbjct: 43 QWHFIKHVTGELNPTLISATLPDLRSSPDRVLTFIENLSPNCLDISCYCLAISILSRLPS 102 Query: 183 PKLALQLV 206 PK A L+ Sbjct: 103 PKQATHLL 110 >ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum lycopersicum] Length = 618 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/68 (47%), Positives = 41/68 (60%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFIK + L PT+IS TL LRS P V F+E + LDI + +A+ I+S PS Sbjct: 43 QWHFIKHVTGELNPTLISATLPELRSSPDRVLTFIENLGPDCLDISCYCLAISILSRLPS 102 Query: 183 PKLALQLV 206 PK A L+ Sbjct: 103 PKQATHLL 110 >ref|XP_006409538.1| hypothetical protein EUTSA_v10022592mg [Eutrema salsugineum] gi|557110700|gb|ESQ50991.1| hypothetical protein EUTSA_v10022592mg [Eutrema salsugineum] Length = 633 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/68 (42%), Positives = 44/68 (64%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHF++Q++ +TP+++S TLLNL P L F++ ID LD +A+ ++S S Sbjct: 59 QWHFVEQLSDKITPSVVSTTLLNLVKTPDLALSFVKHIDLRFLDFSTQCLAIAVVSKLSS 118 Query: 183 PKLALQLV 206 PK ALQL+ Sbjct: 119 PKPALQLL 126 >gb|EXC05161.1| hypothetical protein L484_003967 [Morus notabilis] Length = 634 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/68 (44%), Positives = 44/68 (64%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFIKQ + L+ ++ISDTL L P LV F+ QI+ L++++ +A I++ PS Sbjct: 60 QWHFIKQHSRNLSTSLISDTLCTLHQTPQLVLKFINQIEFDRLNVESLCLATTILAPIPS 119 Query: 183 PKLALQLV 206 PK AL L+ Sbjct: 120 PKTALHLL 127 >gb|EOX97196.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] Length = 494 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFIK +S L P++IS LLNL P L F I+ LD+ +A+ + S PS Sbjct: 75 QWHFIKHQSSDLNPSVISTVLLNLHKTPELALQFTSHIEFQRLDVKTRCLAIAVASRLPS 134 Query: 183 PKLALQLV 206 PK LQL+ Sbjct: 135 PKPTLQLL 142 >gb|EOX97191.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705296|gb|EOX97192.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705297|gb|EOX97193.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705298|gb|EOX97194.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705299|gb|EOX97195.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705301|gb|EOX97197.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 650 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFIK +S L P++IS LLNL P L F I+ LD+ +A+ + S PS Sbjct: 75 QWHFIKHQSSDLNPSVISTVLLNLHKTPELALQFTSHIEFQRLDVKTRCLAIAVASRLPS 134 Query: 183 PKLALQLV 206 PK LQL+ Sbjct: 135 PKPTLQLL 142 >gb|EMJ02723.1| hypothetical protein PRUPE_ppa015625mg, partial [Prunus persica] Length = 545 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/67 (38%), Positives = 42/67 (62%) Frame = +3 Query: 6 WHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPSP 185 WHFIK ++ L+P++IS+ L L+ P LV F+ +D LDI +A+ I++ SP Sbjct: 1 WHFIKHLSPNLSPSLISEALFELQKSPQLVLEFISNVDFHRLDIQTRCLAIAIVARQSSP 60 Query: 186 KLALQLV 206 + AL+L+ Sbjct: 61 QPALELL 67 >ref|XP_002519129.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541792|gb|EEF43340.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 643 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/68 (42%), Positives = 41/68 (60%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWH IK +A L+P++IS TLL+L K L F+ I LDI +A+ ++S +PS Sbjct: 69 QWHLIKHLAPNLSPSLISATLLSLHKKSDLALQFVTHIGFKGLDIKTKCLAVAVVSRSPS 128 Query: 183 PKLALQLV 206 PK L L+ Sbjct: 129 PKSTLHLL 136 >gb|ESW33628.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris] Length = 618 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 3/70 (4%) Frame = +3 Query: 6 WHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTH---LDIDAFSIALVIISLN 176 WHFIKQ A TP+++S TL +LR+ P LV FL + NTH LD+ S+A I+ Sbjct: 43 WHFIKQAAPHYTPSILSSTLTSLRNNPQLVLQFLSHL-NTHPHSLDLTTSSLAACILCRL 101 Query: 177 PSPKLALQLV 206 PSPK ++ L+ Sbjct: 102 PSPKPSINLL 111 >ref|XP_003540687.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Glycine max] Length = 623 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDN--THLDIDAFSIALVIISLN 176 QWHFI+Q+A LTP+++S TL LR P LV L + N LD+ S+A+ ++ Sbjct: 47 QWHFIEQVAPHLTPSLLSSTLTTLRHNPQLVLHLLSHLQNHPHSLDLATSSLAICVLYRL 106 Query: 177 PSPKLALQLV 206 PSPK ++ L+ Sbjct: 107 PSPKPSINLI 116 >ref|NP_179165.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75216226|sp|Q9ZQF1.1|PP152_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g15630, mitochondrial; Flags: Precursor gi|4335729|gb|AAD17407.1| putative salt-inducible protein [Arabidopsis thaliana] gi|330251331|gb|AEC06425.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 627 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/68 (39%), Positives = 39/68 (57%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWH ++ +A LTP+++S TLL+L P L F+ ID LD +A+ +IS S Sbjct: 58 QWHIVEHVADKLTPSLVSTTLLSLVKTPNLAFNFVNHIDLYRLDFQTQCLAIAVISKLSS 117 Query: 183 PKLALQLV 206 PK QL+ Sbjct: 118 PKPVTQLL 125 >ref|XP_002330266.1| predicted protein [Populus trichocarpa] Length = 590 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/68 (41%), Positives = 41/68 (60%) Frame = +3 Query: 3 QWHFIKQIASTLTPTMISDTLLNLRSKPTLVSVFLEQIDNTHLDIDAFSIALVIISLNPS 182 QWHFIK +A +TP++IS L +L P L F+ I LDI + +A+ +IS P+ Sbjct: 24 QWHFIKHLAHKITPSLISTALTSLHKTPDLAFQFVTHIGFGDLDIKSKCLAMAVISHAPN 83 Query: 183 PKLALQLV 206 K +LQL+ Sbjct: 84 SKPSLQLL 91