BLASTX nr result
ID: Achyranthes22_contig00065108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00065108 (327 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006488016.1| PREDICTED: probable glucuronoxylan glucurono... 56 6e-06 ref|XP_006488015.1| PREDICTED: probable glucuronoxylan glucurono... 56 6e-06 ref|XP_006424465.1| hypothetical protein CICLE_v10028404mg [Citr... 56 6e-06 ref|XP_006424464.1| hypothetical protein CICLE_v10028404mg [Citr... 56 6e-06 ref|XP_006424463.1| hypothetical protein CICLE_v10028404mg [Citr... 56 6e-06 ref|XP_003539788.1| PREDICTED: probable glucuronoxylan glucurono... 55 1e-05 ref|XP_002879114.1| hypothetical protein ARALYDRAFT_481698 [Arab... 55 1e-05 ref|XP_002523710.1| transferase, putative [Ricinus communis] gi|... 55 1e-05 >ref|XP_006488016.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like isoform X2 [Citrus sinensis] Length = 454 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 227 NIKIYVYELPSKYNQDWSINNDRCNKHLFASEV 325 ++KIYVYELPSKYN DW ++N+RC+ HLFASEV Sbjct: 99 DLKIYVYELPSKYNTDW-LSNERCSNHLFASEV 130 >ref|XP_006488015.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like isoform X1 [Citrus sinensis] Length = 457 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 227 NIKIYVYELPSKYNQDWSINNDRCNKHLFASEV 325 ++KIYVYELPSKYN DW ++N+RC+ HLFASEV Sbjct: 102 DLKIYVYELPSKYNTDW-LSNERCSNHLFASEV 133 >ref|XP_006424465.1| hypothetical protein CICLE_v10028404mg [Citrus clementina] gi|557526399|gb|ESR37705.1| hypothetical protein CICLE_v10028404mg [Citrus clementina] Length = 457 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 227 NIKIYVYELPSKYNQDWSINNDRCNKHLFASEV 325 ++KIYVYELPSKYN DW ++N+RC+ HLFASEV Sbjct: 102 DLKIYVYELPSKYNTDW-LSNERCSNHLFASEV 133 >ref|XP_006424464.1| hypothetical protein CICLE_v10028404mg [Citrus clementina] gi|557526398|gb|ESR37704.1| hypothetical protein CICLE_v10028404mg [Citrus clementina] Length = 330 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 227 NIKIYVYELPSKYNQDWSINNDRCNKHLFASEV 325 ++KIYVYELPSKYN DW ++N+RC+ HLFASEV Sbjct: 102 DLKIYVYELPSKYNTDW-LSNERCSNHLFASEV 133 >ref|XP_006424463.1| hypothetical protein CICLE_v10028404mg [Citrus clementina] gi|557526397|gb|ESR37703.1| hypothetical protein CICLE_v10028404mg [Citrus clementina] Length = 273 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 227 NIKIYVYELPSKYNQDWSINNDRCNKHLFASEV 325 ++KIYVYELPSKYN DW ++N+RC+ HLFASEV Sbjct: 102 DLKIYVYELPSKYNTDW-LSNERCSNHLFASEV 133 >ref|XP_003539788.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like isoform X1 [Glycine max] gi|571492588|ref|XP_006592279.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like isoform X2 [Glycine max] gi|571492591|ref|XP_006592280.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like isoform X3 [Glycine max] Length = 461 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = +2 Query: 227 NIKIYVYELPSKYNQDWSINNDRCNKHLFASEV 325 N+K++VY+LP KYN DW ++N+RC+KHLFASEV Sbjct: 102 NLKVFVYDLPQKYNTDW-LSNERCSKHLFASEV 133 >ref|XP_002879114.1| hypothetical protein ARALYDRAFT_481698 [Arabidopsis lyrata subsp. lyrata] gi|297324953|gb|EFH55373.1| hypothetical protein ARALYDRAFT_481698 [Arabidopsis lyrata subsp. lyrata] Length = 452 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 227 NIKIYVYELPSKYNQDWSINNDRCNKHLFASEV 325 N+KIYVY+LPSK+N+DW + NDRC+ HLFA+EV Sbjct: 97 NLKIYVYDLPSKFNKDW-LANDRCSNHLFAAEV 128 >ref|XP_002523710.1| transferase, putative [Ricinus communis] gi|223537014|gb|EEF38650.1| transferase, putative [Ricinus communis] Length = 461 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 227 NIKIYVYELPSKYNQDWSINNDRCNKHLFASEV 325 ++KIY+YELPSKYN+DW ++N RC+ HLFASEV Sbjct: 106 DLKIYIYELPSKYNRDW-LSNKRCSNHLFASEV 137