BLASTX nr result
ID: Achyranthes22_contig00064680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00064680 (276 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [S... 56 4e-06 >ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor] gi|241928093|gb|EES01238.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor] Length = 1567 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 1/86 (1%) Frame = -1 Query: 276 KCYDLSTNKIFISRHVIFDETQFPFSKTLTPTPTSYDFLNHGLYPVTVHHSHIH-PIHLA 100 +CYDL++ ++ ISRHV+FDE+ FPFS T TP TS H L+ V + P + Sbjct: 833 RCYDLTSRRVLISRHVVFDESIFPFSTTTTPASTS----EHDLFSVFPTDPVVEPPFPVF 888 Query: 99 PPTSPSNPIQQHSESGSYSTRPTISP 22 P + ++P+ + + P +SP Sbjct: 889 PAGTATSPVVRDTSGPLPCPGPEVSP 914