BLASTX nr result
ID: Achyranthes22_contig00064586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00064586 (438 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468133.1| PREDICTED: uncharacterized protein LOC102622... 57 3e-06 ref|XP_006431971.1| hypothetical protein CICLE_v10001075mg [Citr... 57 3e-06 ref|XP_006431970.1| hypothetical protein CICLE_v10001075mg [Citr... 57 3e-06 gb|EOY34642.1| Mitochondrial 28S ribosomal protein S29-related [... 55 7e-06 >ref|XP_006468133.1| PREDICTED: uncharacterized protein LOC102622498 [Citrus sinensis] Length = 464 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 112 LLCTLAPKVRK*IVLDGPRCCDKSIALAMLAHWARDE 2 L T PK+RK IVLDGP CC KSI LAML HWAR+E Sbjct: 181 LQSTNGPKIRKQIVLDGPLCCGKSITLAMLVHWAREE 217 >ref|XP_006431971.1| hypothetical protein CICLE_v10001075mg [Citrus clementina] gi|557534093|gb|ESR45211.1| hypothetical protein CICLE_v10001075mg [Citrus clementina] Length = 464 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 112 LLCTLAPKVRK*IVLDGPRCCDKSIALAMLAHWARDE 2 L T PK+RK IVLDGP CC KSI LAML HWAR+E Sbjct: 181 LQSTNGPKIRKQIVLDGPLCCGKSITLAMLVHWAREE 217 >ref|XP_006431970.1| hypothetical protein CICLE_v10001075mg [Citrus clementina] gi|557534092|gb|ESR45210.1| hypothetical protein CICLE_v10001075mg [Citrus clementina] Length = 382 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 112 LLCTLAPKVRK*IVLDGPRCCDKSIALAMLAHWARDE 2 L T PK+RK IVLDGP CC KSI LAML HWAR+E Sbjct: 181 LQSTNGPKIRKQIVLDGPLCCGKSITLAMLVHWAREE 217 >gb|EOY34642.1| Mitochondrial 28S ribosomal protein S29-related [Theobroma cacao] Length = 514 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 103 TLAPKVRK*IVLDGPRCCDKSIALAMLAHWARDE 2 T APK RK +VLDGP C KSIALAML HWARDE Sbjct: 234 TKAPKARKQVVLDGPVSCGKSIALAMLVHWARDE 267