BLASTX nr result
ID: Achyranthes22_contig00062957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00062957 (299 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006396596.1| hypothetical protein EUTSA_v10029312mg [Eutr... 56 6e-06 >ref|XP_006396596.1| hypothetical protein EUTSA_v10029312mg [Eutrema salsugineum] gi|557097613|gb|ESQ38049.1| hypothetical protein EUTSA_v10029312mg [Eutrema salsugineum] Length = 671 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +3 Query: 132 LGSGSATQSIENKEEQPLWQYVIKLEKKGAVDETWLYKCNFCDEIRTGSYTRVQTN 299 +GS QS ++ PLW YV KLEK+G T +KC+FC EIR GSY+RV+ + Sbjct: 16 IGSTDTNQS----DDAPLWSYVSKLEKQGEKGGTRKFKCSFCSEIRQGSYSRVRAH 67