BLASTX nr result
ID: Achyranthes22_contig00062922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00062922 (433 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulga... 59 7e-07 >emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1363 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/77 (38%), Positives = 41/77 (53%), Gaps = 8/77 (10%) Frame = +2 Query: 56 LRTNLFPYSILDELEKCCRSLLRTK------LTNLEWD--VYPDKIGSLGLRHLQYWNMT 211 ++++L P S+++E+EK CR L K L + WD P G LG R L WN+ Sbjct: 808 MQSSLLPVSVMNEIEKDCRKFLWNKMDKSHYLARMSWDRICSPTGKGGLGFRRLHNWNLA 867 Query: 212 FMANWGWKILM*PNKLW 262 FMA GW I+ KLW Sbjct: 868 FMAKLGWMIIKDETKLW 884