BLASTX nr result
ID: Achyranthes22_contig00062725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00062725 (215 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ17246.1| hypothetical protein PRUPE_ppa017581mg, partial [... 38 8e-06 >gb|EMJ17246.1| hypothetical protein PRUPE_ppa017581mg, partial [Prunus persica] Length = 713 Score = 37.7 bits (86), Expect(2) = 8e-06 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = -1 Query: 215 LQAAQQSEIANKIANEGVKTGRGLNQIGNLQQAMD 111 L+ AQ +EI + IA + ++TG+G+NQIG LQ+A D Sbjct: 377 LKNAQAAEIEHMIAIDELETGKGMNQIGTLQRAGD 411 Score = 37.4 bits (85), Expect(2) = 8e-06 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -2 Query: 118 RWTSHLNSVTSLIGKFSATGKALKSVIKVGNC-EQRASAD 2 RW SHL S+TSL+ FSAT L ++I G QR AD Sbjct: 413 RWGSHLKSITSLVNMFSATCMVLINIIDNGTTYSQRGDAD 452