BLASTX nr result
ID: Achyranthes22_contig00062662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00062662 (281 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523570.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002523570.1| conserved hypothetical protein [Ricinus communis] gi|223537132|gb|EEF38765.1| conserved hypothetical protein [Ricinus communis] Length = 207 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 126 LHIQQDTIVDLLGVIGRRSKLPMVVCCSSRNDLDA 230 LH + +T+V+LLGV GRRS LPMVVCCSSR++LDA Sbjct: 29 LHFKMETLVELLGVAGRRSGLPMVVCCSSRDELDA 63