BLASTX nr result
ID: Achyranthes22_contig00062544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00062544 (443 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM64837.1| hypothetical protein [Beta vulgaris] 57 3e-06 >dbj|BAM64837.1| hypothetical protein [Beta vulgaris] Length = 1928 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -3 Query: 339 HALSDKPKNEWIQLSVGKFKTSSKTFGQKLSFSMDFVQPGMMIIKGVFI 193 H LSDKP++EWI+LSVGKFKTSS G K++FS++ ++P +II+GV I Sbjct: 1758 HDLSDKPRDEWIRLSVGKFKTSSAHVG-KMTFSLEEIEP-QLIIQGVCI 1804