BLASTX nr result
ID: Achyranthes22_contig00062432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00062432 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004499325.1| PREDICTED: 4-coumarate--CoA ligase-like 5-li... 50 1e-05 >ref|XP_004499325.1| PREDICTED: 4-coumarate--CoA ligase-like 5-like [Cicer arietinum] Length = 539 Score = 50.4 bits (119), Expect(2) = 1e-05 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -2 Query: 267 GMFCYIDEDRFLFVVDRLKELIKYEEYQVP 178 G CYID D F+F+VDRLKELIKY+ YQVP Sbjct: 418 GDVCYIDSDGFVFIVDRLKELIKYKGYQVP 447 Score = 24.3 bits (51), Expect(2) = 1e-05 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 322 SN*HELT*TLTSNRWLKSRDV 260 SN T TLTS+ WLK+ DV Sbjct: 400 SNEEATTSTLTSDGWLKTGDV 420