BLASTX nr result
ID: Achyranthes22_contig00061649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00061649 (230 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitoc... 85 9e-15 gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta] 84 2e-14 ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citr... 83 3e-14 ref|XP_006344463.1| PREDICTED: ferric reduction oxidase 8, mitoc... 82 6e-14 ref|XP_004236257.1| PREDICTED: ferric reduction oxidase 8, mitoc... 82 6e-14 ref|XP_004299137.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduc... 80 2e-13 ref|XP_004515872.1| PREDICTED: ferric reduction oxidase 8, mitoc... 80 3e-13 ref|XP_002321628.1| ferric reductase-like transmembrane componen... 80 4e-13 ref|XP_002318065.1| ferric reductase-like transmembrane componen... 79 8e-13 ref|XP_004168892.1| PREDICTED: ferric reduction oxidase 8, mitoc... 77 2e-12 ref|XP_004140645.1| PREDICTED: ferric reduction oxidase 8, mitoc... 77 2e-12 gb|EXB93548.1| Ferric reduction oxidase 8 [Morus notabilis] 76 4e-12 gb|EOY20822.1| Ferric reduction oxidase 8 isoform 1 [Theobroma c... 76 4e-12 dbj|BAB09387.1| FRO1 and FRO2-like protein [Arabidopsis thaliana] 74 2e-11 ref|NP_199827.2| ferric reduction oxidase 8 [Arabidopsis thalian... 74 2e-11 ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitoc... 74 2e-11 ref|XP_002864039.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrat... 74 2e-11 ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus ... 73 5e-11 ref|XP_002277760.1| PREDICTED: ferric reduction oxidase 8, mitoc... 72 6e-11 gb|ESW27469.1| hypothetical protein PHAVU_003G204400g [Phaseolus... 72 8e-11 >ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Citrus sinensis] Length = 713 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/76 (51%), Positives = 54/76 (71%) Frame = -3 Query: 228 PKSKIRRRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLI 49 P+ R+ R T L NPL+V + +G+LS ++L + L + LVWT+YARISND+KKL+ Sbjct: 77 PRKPRIRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDFKKLM 136 Query: 48 PVKPMKLNIWQLKFFR 1 PVK +KLN WQLK+ R Sbjct: 137 PVKSLKLNTWQLKYLR 152 >gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta] Length = 722 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/75 (49%), Positives = 55/75 (73%) Frame = -3 Query: 225 KSKIRRRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIP 46 K +RR+ T NP++V + +G+LSGI++L + L + LL WT+Y RISND+KKL+P Sbjct: 79 KETLRRKASSSTTGFSNPVIVNSFIGILSGIEILWVFLFILLLGWTYYTRISNDFKKLMP 138 Query: 45 VKPMKLNIWQLKFFR 1 +K +KLN+WQLK+ R Sbjct: 139 IKLLKLNLWQLKYLR 153 >ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citrus clementina] gi|557542174|gb|ESR53152.1| hypothetical protein CICLE_v10019061mg [Citrus clementina] Length = 713 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/76 (50%), Positives = 54/76 (71%) Frame = -3 Query: 228 PKSKIRRRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLI 49 P+ R+ R T L NPL+V + +G+LS ++L + L + LVWT+YARISND+KKL+ Sbjct: 77 PRKPRIRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDFKKLM 136 Query: 48 PVKPMKLNIWQLKFFR 1 PVK +KL+ WQLK+ R Sbjct: 137 PVKSLKLDTWQLKYLR 152 >ref|XP_006344463.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Solanum tuberosum] Length = 699 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/75 (48%), Positives = 53/75 (70%) Frame = -3 Query: 225 KSKIRRRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIP 46 K I R+ R L+VL NP++V +G+LSG ++LA+ L + L WTFY RISND+KK++P Sbjct: 77 KEPISRKGRSSLSVLSNPVVVNKYIGILSGFEILAVCLFVIFLAWTFYVRISNDFKKMVP 136 Query: 45 VKPMKLNIWQLKFFR 1 +K L++WQ + FR Sbjct: 137 MKSFTLSVWQYRVFR 151 >ref|XP_004236257.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Solanum lycopersicum] Length = 699 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/75 (48%), Positives = 53/75 (70%) Frame = -3 Query: 225 KSKIRRRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIP 46 K I R+ R L+VL NP++V +G+LSG ++LA+ L + L WTFY RISND+KK++P Sbjct: 77 KEAISRKGRSSLSVLSNPVVVNKYIGILSGFEILAVCLFVIFLAWTFYVRISNDFKKMVP 136 Query: 45 VKPMKLNIWQLKFFR 1 +K L++WQ + FR Sbjct: 137 MKSFTLSVWQYRVFR 151 >ref|XP_004299137.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 8, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 704 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/77 (50%), Positives = 54/77 (70%), Gaps = 1/77 (1%) Frame = -3 Query: 228 PKSKIRR-RVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKL 52 P+ IRR + RR NPL+V + LG+LS I+++A+ L + L WTFY RIS+D+KKL Sbjct: 78 PREPIRRXKGRRVFAGFSNPLVVNSLLGILSSIEIVAVFLFMLFLAWTFYVRISSDFKKL 137 Query: 51 IPVKPMKLNIWQLKFFR 1 P K +KLN+WQLK+ R Sbjct: 138 KPDKALKLNLWQLKYLR 154 >ref|XP_004515872.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cicer arietinum] Length = 714 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/70 (52%), Positives = 48/70 (68%) Frame = -3 Query: 210 RRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMK 31 R RR V N L+V + G+LS +++L L + L WTFYARISND+KKL+P K +K Sbjct: 85 RSARRSSIVFSNQLVVNSVFGILSSVEILIAFLFMVFLAWTFYARISNDFKKLMPDKSLK 144 Query: 30 LNIWQLKFFR 1 LNIWQLK+ R Sbjct: 145 LNIWQLKYLR 154 >ref|XP_002321628.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] gi|222868624|gb|EEF05755.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] Length = 722 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/72 (51%), Positives = 54/72 (75%), Gaps = 1/72 (1%) Frame = -3 Query: 213 RRRVRRCLTVLY-NPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKP 37 R R R T+ + NP+LV + LG+LS I++LA+ L + L WT+YARISND+KKL+P+K Sbjct: 83 RSRPARSATIGFSNPVLVNSFLGILSSIEILAVFLFVLFLAWTYYARISNDFKKLMPIKS 142 Query: 36 MKLNIWQLKFFR 1 + L++WQLK+ R Sbjct: 143 LNLDLWQLKYLR 154 >ref|XP_002318065.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] gi|222858738|gb|EEE96285.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] Length = 743 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/76 (48%), Positives = 55/76 (72%), Gaps = 1/76 (1%) Frame = -3 Query: 225 KSKIRRRVRRCLTVLY-NPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLI 49 K R R R TV + NP++V + +G+LS +++LA+ L L WT+YARISND+KKL+ Sbjct: 79 KEPPRSRPARSATVGFSNPVVVNSFVGILSSLEILAVFLFFLFLAWTYYARISNDFKKLM 138 Query: 48 PVKPMKLNIWQLKFFR 1 PVK +KL++WQ+K+ R Sbjct: 139 PVKSLKLDLWQIKYLR 154 >ref|XP_004168892.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cucumis sativus] Length = 716 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/61 (55%), Positives = 47/61 (77%) Frame = -3 Query: 183 LYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMKLNIWQLKFF 4 L NPL+V LG+LSGI++L ++L L L WTFYARIS D++KL+PV+ + L IW+LK+ Sbjct: 99 LSNPLVVNNYLGILSGIELLGVALFLLFLAWTFYARISKDFRKLLPVESLNLKIWELKYL 158 Query: 3 R 1 R Sbjct: 159 R 159 >ref|XP_004140645.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cucumis sativus] Length = 716 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/61 (55%), Positives = 47/61 (77%) Frame = -3 Query: 183 LYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMKLNIWQLKFF 4 L NPL+V LG+LSGI++L ++L L L WTFYARIS D++KL+PV+ + L IW+LK+ Sbjct: 99 LSNPLVVNNYLGILSGIELLGVALFLLFLAWTFYARISKDFRKLLPVESLNLKIWELKYL 158 Query: 3 R 1 R Sbjct: 159 R 159 >gb|EXB93548.1| Ferric reduction oxidase 8 [Morus notabilis] Length = 711 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/67 (49%), Positives = 48/67 (71%) Frame = -3 Query: 201 RRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMKLNI 22 ++ + + NP++V T LG S +++L++SL L WTFYARISND+K L+PVK +KL Sbjct: 87 KKVFSGISNPVVVNTLLGTFSALEILSISLFALFLAWTFYARISNDFKDLMPVKSLKLKT 146 Query: 21 WQLKFFR 1 WQLK+ R Sbjct: 147 WQLKYLR 153 >gb|EOY20822.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao] Length = 720 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/70 (47%), Positives = 48/70 (68%) Frame = -3 Query: 210 RRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMK 31 R+VR NPL++ +G+LS +++LA+ L L WTFY RIS D+KKL PV+ +K Sbjct: 84 RQVRSSAAAFSNPLVISKLIGILSSVEILAVFLFTLFLAWTFYKRISQDFKKLTPVESLK 143 Query: 30 LNIWQLKFFR 1 L++WQLK+ R Sbjct: 144 LDLWQLKYLR 153 >dbj|BAB09387.1| FRO1 and FRO2-like protein [Arabidopsis thaliana] Length = 713 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/58 (51%), Positives = 45/58 (77%) Frame = -3 Query: 174 PLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMKLNIWQLKFFR 1 P ++ + +G++S ++LA+ L L L W FYAR+SND+KKL+PVK M LN+WQLK++R Sbjct: 97 PAIINSFIGIVSCFEILALLLFLLFLAWNFYARVSNDFKKLMPVKTMNLNLWQLKYYR 154 >ref|NP_199827.2| ferric reduction oxidase 8 [Arabidopsis thaliana] gi|75161398|sp|Q8VY13.1|FRO8_ARATH RecName: Full=Ferric reduction oxidase 8, mitochondrial; Short=AtFRO8; AltName: Full=Ferric-chelate reductase 8; Flags: Precursor gi|18377668|gb|AAL66984.1| putative FRO1 and FRO2 protein [Arabidopsis thaliana] gi|27754744|gb|AAO22815.1| putative FRO1 and FRO2 protein [Arabidopsis thaliana] gi|332008522|gb|AED95905.1| ferric reduction oxidase 8 [Arabidopsis thaliana] Length = 728 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/58 (51%), Positives = 45/58 (77%) Frame = -3 Query: 174 PLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMKLNIWQLKFFR 1 P ++ + +G++S ++LA+ L L L W FYAR+SND+KKL+PVK M LN+WQLK++R Sbjct: 97 PAIINSFIGIVSCFEILALLLFLLFLAWNFYARVSNDFKKLMPVKTMNLNLWQLKYYR 154 >ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Glycine max] Length = 711 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = -3 Query: 177 NPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMKLNIWQLKFFR 1 NPL+V T LG+LS I++L L + L WT+Y+RI D+KKL+P K +KLN WQLK+ R Sbjct: 100 NPLVVNTTLGILSSIEILIAFLFIVFLAWTYYSRIYTDFKKLMPYKSLKLNTWQLKYHR 158 >ref|XP_002864039.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata] gi|297309874|gb|EFH40298.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata] Length = 728 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/67 (44%), Positives = 47/67 (70%) Frame = -3 Query: 201 RRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMKLNI 22 R + P ++ + +G++S ++LA+ L L L W FYAR+SND+KKL+PVK + LN+ Sbjct: 88 RSAAITVSRPAIINSFIGIVSCFEILALLLFLVFLAWNFYARVSNDFKKLMPVKTLNLNL 147 Query: 21 WQLKFFR 1 WQLK++R Sbjct: 148 WQLKYYR 154 >ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus communis] gi|223550445|gb|EEF51932.1| ferric-chelate reductase, putative [Ricinus communis] Length = 726 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/71 (42%), Positives = 50/71 (70%) Frame = -3 Query: 213 RRRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPM 34 RR+ R + + NP++V + +G+LS +++L + + L WT+Y RI+ND+KKL+P K + Sbjct: 84 RRQARIPTSGISNPVIVNSFVGVLSTLEILVVLFFILFLAWTYYVRIANDFKKLMPAKSL 143 Query: 33 KLNIWQLKFFR 1 LN+WQLK+ R Sbjct: 144 NLNLWQLKYLR 154 >ref|XP_002277760.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Vitis vinifera] gi|297733716|emb|CBI14963.3| unnamed protein product [Vitis vinifera] Length = 703 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/71 (49%), Positives = 48/71 (67%) Frame = -3 Query: 213 RRRVRRCLTVLYNPLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPM 34 RR+ RR +VL NPL+V LG+LS +++LA+SL L WTFY ISND++K++P K + Sbjct: 82 RRQARRSASVLSNPLVVNNYLGVLSALEILAVSLFFLYLAWTFYVHISNDFEKMVPAKSL 141 Query: 33 KLNIWQLKFFR 1 K Q KF R Sbjct: 142 KR---QFKFLR 149 >gb|ESW27469.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris] Length = 709 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/58 (55%), Positives = 44/58 (75%) Frame = -3 Query: 174 PLLVKTPLGMLSGIDVLAMSLILTLLVWTFYARISNDYKKLIPVKPMKLNIWQLKFFR 1 PL+V + +G+LS I+VL L + LVWT+Y+RIS D+KKL+P K +KLN WQLK+ R Sbjct: 99 PLVVNSTVGILSIIEVLVAFLFIVFLVWTYYSRISADFKKLVPYKSLKLNTWQLKYHR 156