BLASTX nr result
ID: Achyranthes22_contig00061389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00061389 (389 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838929.1| hypothetical protein AMTR_s00002p00270230 [A... 70 2e-10 ref|XP_006837287.1| hypothetical protein AMTR_s00111p00023340 [A... 70 3e-10 ref|XP_006837338.1| hypothetical protein AMTR_s00111p00086580 [A... 69 6e-10 gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis] 67 2e-09 ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [C... 67 2e-09 ref|XP_006431497.1| hypothetical protein CICLE_v10002413mg [Citr... 67 2e-09 ref|XP_006421625.1| hypothetical protein CICLE_v10005611mg [Citr... 67 2e-09 gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform... 67 2e-09 gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform... 67 2e-09 gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobr... 67 2e-09 ref|XP_004242022.1| PREDICTED: 60S ribosomal protein L15-like [S... 67 2e-09 ref|XP_004241917.1| PREDICTED: 60S ribosomal protein L15-like [S... 67 2e-09 ref|XP_004236901.1| PREDICTED: 60S ribosomal protein L15-like [S... 67 2e-09 ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like is... 67 2e-09 ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like is... 67 2e-09 sp|O82528.1|RL15_PETHY RecName: Full=60S ribosomal protein L15 g... 67 2e-09 gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas] 67 2e-09 ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-like [V... 67 2e-09 ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus com... 67 2e-09 ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus com... 67 2e-09 >ref|XP_006838929.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda] gi|548841435|gb|ERN01498.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda] Length = 204 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/38 (86%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYR-LPSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR LPSIVRV Sbjct: 2 GAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRV 39 >ref|XP_006837287.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda] gi|548839905|gb|ERN00141.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda] Length = 233 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = +2 Query: 203 CSSANPFSFSCQIN*ILHVRSRSLQGAYKYISEQWRKKQSDVMRFTTRVRCWEYR-LPSI 379 C +P ++ C + GAYKY+SE WRKKQSDVMRF RVRCWEYR LPSI Sbjct: 17 CGLVDPHAWKC-----------TFYGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSI 65 Query: 380 VR 385 VR Sbjct: 66 VR 67 >ref|XP_006837338.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda] gi|548839956|gb|ERN00192.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda] Length = 204 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYR-LPSIVR 385 GAYKY+SE WRKKQSDVMRF RVRCWEYR LPSIVR Sbjct: 2 GAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVR 38 >gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis] Length = 241 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 39 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 76 >ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >ref|XP_006431497.1| hypothetical protein CICLE_v10002413mg [Citrus clementina] gi|557533619|gb|ESR44737.1| hypothetical protein CICLE_v10002413mg [Citrus clementina] Length = 220 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >ref|XP_006421625.1| hypothetical protein CICLE_v10005611mg [Citrus clementina] gi|557523498|gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus clementina] Length = 273 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 71 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 108 >gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma cacao] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma cacao] gi|508777037|gb|EOY24293.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma cacao] Length = 206 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 4 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 41 >gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobroma cacao] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >ref|XP_004242022.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum] gi|565396605|ref|XP_006363900.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYR-LPSIVRV 388 GAY Y+SE WRKKQSDVMRF RVRCWEYR LPSIVRV Sbjct: 2 GAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRV 39 >ref|XP_004241917.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum] gi|565377089|ref|XP_006355022.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum] gi|565380256|ref|XP_006356521.1| PREDICTED: 60S ribosomal protein L15 [Solanum tuberosum] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYR-LPSIVRV 388 GAY Y+SE WRKKQSDVMRF RVRCWEYR LPSIVRV Sbjct: 2 GAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRV 39 >ref|XP_004236901.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYR-LPSIVRV 388 GAY Y+SE WRKKQSDVMRF RVRCWEYR LPSIVRV Sbjct: 2 GAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRV 39 >ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449488656|ref|XP_004158132.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449458363|ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis sativus] gi|449520285|ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449520287|ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis sativus] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >sp|O82528.1|RL15_PETHY RecName: Full=60S ribosomal protein L15 gi|3608479|gb|AAD13389.1| ribosomal protein L15 [Petunia x hybrida] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYR-LPSIVRV 388 GAY Y+SE WRKKQSDVMRF RVRCWEYR LPSIVRV Sbjct: 2 GAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRV 39 >gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-like [Vitis vinifera] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis] gi|223550092|gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39 >ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus communis] gi|223529794|gb|EEF31730.1| ribosomal protein L15, putative [Ricinus communis] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +2 Query: 278 GAYKYISEQWRKKQSDVMRFTTRVRCWEYRL-PSIVRV 388 GAYKY+SE WRKKQSDVMRF RVRCWEYR PSIVRV Sbjct: 2 GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRV 39