BLASTX nr result
ID: Achyranthes22_contig00061230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00061230 (269 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293858.1| PREDICTED: protein yippee-like At5g53940-lik... 59 7e-07 gb|EMJ13428.1| hypothetical protein PRUPE_ppa013364mg [Prunus pe... 59 7e-07 gb|EXC30580.1| hypothetical protein L484_015073 [Morus notabilis] 56 6e-06 >ref|XP_004293858.1| PREDICTED: protein yippee-like At5g53940-like [Fragaria vesca subsp. vesca] Length = 126 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +1 Query: 172 MGRVFLVELDGKTYRCRFCDCPLALAEDVLSR 267 MGR+++VEL+G++YRCRFCD PLALA+DVLSR Sbjct: 1 MGRIYVVELEGRSYRCRFCDVPLALADDVLSR 32 >gb|EMJ13428.1| hypothetical protein PRUPE_ppa013364mg [Prunus persica] Length = 127 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 172 MGRVFLVELDGKTYRCRFCDCPLALAEDVLSR 267 MGR+FLVELDG+ YRCR CD PLALA+D++SR Sbjct: 1 MGRIFLVELDGRAYRCRLCDSPLALADDIISR 32 >gb|EXC30580.1| hypothetical protein L484_015073 [Morus notabilis] Length = 127 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +1 Query: 172 MGRVFLVELDGKTYRCRFCDCPLALAEDVLSR 267 MGR+FLVEL+G+ YRC+ CD PLALA++VLSR Sbjct: 1 MGRIFLVELEGRAYRCKLCDSPLALADEVLSR 32