BLASTX nr result
ID: Achyranthes22_contig00061200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00061200 (248 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451203.1| hypothetical protein CICLE_v10007831mg [Citr... 55 7e-06 ref|XP_006475659.1| PREDICTED: probable peptide transporter At1g... 55 1e-05 >ref|XP_006451203.1| hypothetical protein CICLE_v10007831mg [Citrus clementina] gi|557554429|gb|ESR64443.1| hypothetical protein CICLE_v10007831mg [Citrus clementina] Length = 585 Score = 55.5 bits (132), Expect = 7e-06 Identities = 20/47 (42%), Positives = 32/47 (68%) Frame = -1 Query: 248 HFDYYYWITSVLGLFNFFYFLICNKAYGESSTLKLEDDDEIGEDRDV 108 H+DYYYWI +L + NFFYF+ C+ AYG +K+ D+ E ++ ++ Sbjct: 526 HYDYYYWILCILSVVNFFYFIACSWAYGSCEDIKVWDEGEAKKEHEM 572 >ref|XP_006475659.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus sinensis] Length = 585 Score = 55.1 bits (131), Expect = 1e-05 Identities = 20/47 (42%), Positives = 32/47 (68%) Frame = -1 Query: 248 HFDYYYWITSVLGLFNFFYFLICNKAYGESSTLKLEDDDEIGEDRDV 108 H+DYYYWI +L + NFFYF+ C+ AYG +K+ D+ E ++ ++ Sbjct: 526 HYDYYYWILCILSVVNFFYFIACSWAYGSCEDIKVWDEGEAMKEHEM 572