BLASTX nr result
ID: Achyranthes22_contig00061127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00061127 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30873.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002269609.1| PREDICTED: uncharacterized protein LOC100246... 75 1e-11 emb|CAN78735.1| hypothetical protein VITISV_037979 [Vitis vinifera] 75 1e-11 ref|XP_002324541.1| hypothetical protein POPTR_0018s11720g [Popu... 70 3e-10 ref|XP_004293575.1| PREDICTED: uncharacterized protein LOC101304... 67 2e-09 ref|XP_002519687.1| conserved hypothetical protein [Ricinus comm... 66 4e-09 gb|EMJ15621.1| hypothetical protein PRUPE_ppa025875mg [Prunus pe... 64 2e-08 gb|EOY27706.1| Uncharacterized protein TCM_029488 [Theobroma cacao] 61 2e-07 ref|XP_006468190.1| PREDICTED: uncharacterized protein LOC102614... 60 2e-07 ref|XP_006449689.1| hypothetical protein CICLE_v10018291mg [Citr... 60 2e-07 ref|XP_004486024.1| PREDICTED: uncharacterized protein LOC101514... 59 5e-07 gb|ESW19899.1| hypothetical protein PHAVU_006G164800g [Phaseolus... 59 7e-07 ref|XP_006449688.1| hypothetical protein CICLE_v10015169mg [Citr... 58 1e-06 ref|XP_004166325.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 57 2e-06 ref|XP_004134914.1| PREDICTED: uncharacterized protein LOC101215... 57 2e-06 ref|XP_003547205.1| PREDICTED: uncharacterized protein LOC100809... 56 4e-06 ref|XP_003593929.1| hypothetical protein MTR_2g019450 [Medicago ... 56 4e-06 ref|XP_006280347.1| hypothetical protein CARUB_v10026274mg, part... 56 6e-06 ref|NP_199434.2| uncharacterized protein [Arabidopsis thaliana] ... 56 6e-06 ref|XP_004244805.1| PREDICTED: uncharacterized protein LOC101267... 55 1e-05 >emb|CBI30873.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = +2 Query: 80 LSMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 L+ PLL QSKRLC S LYL T+LFLA+YV++SP KCI F S+P+DPIQ+PLFSY Sbjct: 12 LTTPLLFQSKRLCFSVLYLFTTLFLALYVSLSPT-KCI-FRSSPFDPIQAPLFSY 64 >ref|XP_002269609.1| PREDICTED: uncharacterized protein LOC100246938 [Vitis vinifera] Length = 450 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = +2 Query: 80 LSMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 L+ PLL QSKRLC S LYL T+LFLA+YV++SP KCI F S+P+DPIQ+PLFSY Sbjct: 6 LTTPLLFQSKRLCFSVLYLFTTLFLALYVSLSPT-KCI-FRSSPFDPIQAPLFSY 58 >emb|CAN78735.1| hypothetical protein VITISV_037979 [Vitis vinifera] Length = 545 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = +2 Query: 80 LSMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 L+ PLL QSKRLC S LYL T+LFLA+YV++SP KCI F S+P+DPIQ+PLFSY Sbjct: 12 LTTPLLFQSKRLCFSVLYLFTTLFLALYVSLSPT-KCI-FRSSPFDPIQAPLFSY 64 >ref|XP_002324541.1| hypothetical protein POPTR_0018s11720g [Populus trichocarpa] gi|222865975|gb|EEF03106.1| hypothetical protein POPTR_0018s11720g [Populus trichocarpa] Length = 450 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/55 (65%), Positives = 44/55 (80%) Frame = +2 Query: 80 LSMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 LS PL+ QSK LC+S LYLIT+LFLA+Y +I P KC LF S+P+DPIQ+P FSY Sbjct: 6 LSKPLIFQSKLLCISLLYLITTLFLALYTSIYPT-KC-LFRSSPFDPIQTPFFSY 58 >ref|XP_004293575.1| PREDICTED: uncharacterized protein LOC101304546 [Fragaria vesca subsp. vesca] Length = 458 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = +2 Query: 83 SMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 S PLL QSK +C S LYL TSLFLA+Y ++S + KC LF S+P+DPIQ+PLFSY Sbjct: 6 STPLLFQSKLVCFSLLYLFTSLFLALYTSLS-QSKC-LFRSSPFDPIQTPLFSY 57 >ref|XP_002519687.1| conserved hypothetical protein [Ricinus communis] gi|223541104|gb|EEF42660.1| conserved hypothetical protein [Ricinus communis] Length = 456 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = +2 Query: 80 LSMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 LS PL+ QSK C+S LYL T+LFLA+Y ++ P KC LF S+P+DP+Q PLFSY Sbjct: 6 LSTPLIFQSKLFCISLLYLFTTLFLALYTSLHPT-KC-LFRSSPFDPLQLPLFSY 58 >gb|EMJ15621.1| hypothetical protein PRUPE_ppa025875mg [Prunus persica] Length = 459 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +2 Query: 83 SMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 S PLL QSK + S LYL TSLFLA+Y ++S + KC LF S+P+DPIQ+PLFSY Sbjct: 6 STPLLFQSKLVFFSLLYLFTSLFLAIYTSLS-QTKC-LFRSSPFDPIQAPLFSY 57 >gb|EOY27706.1| Uncharacterized protein TCM_029488 [Theobroma cacao] Length = 455 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +2 Query: 89 PLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 PL QSK LC+S LYL T+L LA+Y ++S KC LF S+P+DPIQ+P FSY Sbjct: 10 PLFFQSKLLCISLLYLFTTLLLAIYHSLSST-KC-LFRSSPFDPIQTPFFSY 59 >ref|XP_006468190.1| PREDICTED: uncharacterized protein LOC102614591 [Citrus sinensis] Length = 456 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +2 Query: 89 PLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 P L QSK LC S LYL + +FLA+Y +SP KC LF S+P+DPIQ+PLFSY Sbjct: 10 PPLCQSKLLCTSLLYLFSVMFLALYNALSPT-KC-LFRSSPFDPIQAPLFSY 59 >ref|XP_006449689.1| hypothetical protein CICLE_v10018291mg [Citrus clementina] gi|557552300|gb|ESR62929.1| hypothetical protein CICLE_v10018291mg [Citrus clementina] Length = 456 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +2 Query: 89 PLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 P L QSK LC S LYL + +FLA+Y +SP KC LF S+P+DPIQ+PLFSY Sbjct: 10 PPLCQSKLLCTSLLYLFSVMFLALYNALSPT-KC-LFRSSPFDPIQAPLFSY 59 >ref|XP_004486024.1| PREDICTED: uncharacterized protein LOC101514291 [Cicer arietinum] Length = 456 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +2 Query: 83 SMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 S PL+LQSK LC S LYL T+LFLA+Y T+S + KC F S+P DPI + LF+Y Sbjct: 8 SKPLILQSKLLCFSLLYLFTTLFLALYTTLS-QSKC-FFRSSPSDPILNSLFNY 59 >gb|ESW19899.1| hypothetical protein PHAVU_006G164800g [Phaseolus vulgaris] Length = 454 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +2 Query: 89 PLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 PL+L SK LC S LYL T+LFLA+Y T+S KC F S+P DP+Q+ LFSY Sbjct: 10 PLILYSKLLCFSLLYLFTTLFLALYTTLS-HSKC-FFRSSPLDPLQNSLFSY 59 >ref|XP_006449688.1| hypothetical protein CICLE_v10015169mg [Citrus clementina] gi|557552299|gb|ESR62928.1| hypothetical protein CICLE_v10015169mg [Citrus clementina] Length = 463 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +2 Query: 80 LSMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 L +PLL QSK LC S LYL T+LFLA+ ++SP +C F P+DPIQ+PLF+Y Sbjct: 13 LQIPLLFQSKLLCFSLLYLATTLFLALRNSLSPS-QC-GFKDPPFDPIQTPLFTY 65 >ref|XP_004166325.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101215259 [Cucumis sativus] Length = 467 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +2 Query: 83 SMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 S PLL QSK C S YL +S+FLA+Y ++S KC LF S+P+DPIQ LFSY Sbjct: 7 STPLLFQSKFFCFSLFYLSSSIFLALYTSLSSS-KC-LFRSSPFDPIQFSLFSY 58 >ref|XP_004134914.1| PREDICTED: uncharacterized protein LOC101215259 [Cucumis sativus] Length = 467 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +2 Query: 83 SMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 S PLL QSK C S YL +S+FLA+Y ++S KC LF S+P+DPIQ LFSY Sbjct: 7 STPLLFQSKFFCFSLFYLSSSIFLALYTSLSSS-KC-LFRSSPFDPIQFSLFSY 58 >ref|XP_003547205.1| PREDICTED: uncharacterized protein LOC100809755 [Glycine max] Length = 458 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = +2 Query: 83 SMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 S PL+ SK LC S YL T+LFLA+Y ++S + KC F S+P DP+Q+ LFSY Sbjct: 8 SKPLIFHSKLLCFSLFYLFTTLFLALYTSLS-QSKC-FFRSSPSDPVQNSLFSY 59 >ref|XP_003593929.1| hypothetical protein MTR_2g019450 [Medicago truncatula] gi|355482977|gb|AES64180.1| hypothetical protein MTR_2g019450 [Medicago truncatula] Length = 457 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = +2 Query: 83 SMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 S PL+L+SK LC S YL T+LFLA+Y T+S + KC F S+P DPI + LF+Y Sbjct: 8 SKPLILKSKLLCFSLFYLFTTLFLALYTTLS-QSKC-FFRSSPSDPILNSLFNY 59 >ref|XP_006280347.1| hypothetical protein CARUB_v10026274mg, partial [Capsella rubella] gi|482549051|gb|EOA13245.1| hypothetical protein CARUB_v10026274mg, partial [Capsella rubella] Length = 499 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = +2 Query: 80 LSMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 LS PL +SK LC S +YL T+LFL +YV++S R +C+ F +P+DPIQ LFSY Sbjct: 44 LSPPLYAKSKLLCFSLVYLFTTLFLFLYVSLS-RNQCV-FRYSPFDPIQPKLFSY 96 >ref|NP_199434.2| uncharacterized protein [Arabidopsis thaliana] gi|50253510|gb|AAT71957.1| At5g46220 [Arabidopsis thaliana] gi|56381965|gb|AAV85701.1| At5g46220 [Arabidopsis thaliana] gi|332007971|gb|AED95354.1| uncharacterized protein AT5G46220 [Arabidopsis thaliana] Length = 462 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = +2 Query: 80 LSMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 LS PL +SK LC S LYL +++FL +YV++S R +CI F +P+DPIQ+ LFSY Sbjct: 9 LSPPLYARSKLLCFSLLYLFSTIFLFLYVSLS-RNQCI-FRYSPFDPIQAKLFSY 61 >ref|XP_004244805.1| PREDICTED: uncharacterized protein LOC101267330 [Solanum lycopersicum] Length = 454 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/54 (53%), Positives = 33/54 (61%) Frame = +2 Query: 83 SMPLLLQSKRLCLSCLYLITSLFLAVYVTISPRFKCILFGSAPYDPIQSPLFSY 244 S PL SK LC+S +YL TSLFL VY + C LF +P DPIQ PLF Y Sbjct: 8 SKPLFCYSKLLCISVIYLFTSLFLVVYTSFISPTNC-LFRYSPNDPIQKPLFIY 60