BLASTX nr result
ID: Achyranthes22_contig00061115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00061115 (324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428422.1| hypothetical protein CICLE_v10013401mg [Citr... 55 7e-06 >ref|XP_006428422.1| hypothetical protein CICLE_v10013401mg [Citrus clementina] gi|568877463|ref|XP_006491755.1| PREDICTED: uncharacterized protein LOC102613820 [Citrus sinensis] gi|557530479|gb|ESR41662.1| hypothetical protein CICLE_v10013401mg [Citrus clementina] Length = 118 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/53 (58%), Positives = 35/53 (66%) Frame = +1 Query: 4 KHHRRYGSTGAVGFNVGDEDDEPKLVRSGGLRRDWSFENLYAQQRDEKRSKLR 162 K HRR STGAV F D EPKLVRS G+RRDWSFE+L Q+ +E R R Sbjct: 68 KSHRRLNSTGAVAFTT---DTEPKLVRSVGMRRDWSFEDL-RQRNNETRKGAR 116