BLASTX nr result
ID: Achyranthes22_contig00061094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00061094 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78967.1| hypothetical protein VITISV_027273 [Vitis vinifera] 58 2e-06 >emb|CAN78967.1| hypothetical protein VITISV_027273 [Vitis vinifera] Length = 1163 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/104 (32%), Positives = 52/104 (50%), Gaps = 1/104 (0%) Frame = -3 Query: 349 IQEKYELPQEDHIGRALEVQCMNLFRHWRERLKCKYFKGKNT**SNNIF-PYNVETKQWE 173 + EKYEL E+ + C NLFR +R ++K KY+ NT P ++ W Sbjct: 893 VLEKYEL--EETCKSYILQCCGNLFRSYRNKMKAKYYNPYNTDEERLCQRPPHLSDDDWR 950 Query: 172 WLCHHWNSPKQKAKSEMNKVNEKNKKIYSACDAKSAARILHDME 41 WL H W +P+ K S+ NK N + I +KS A+I ++ + Sbjct: 951 WLIHFWGTPEAKDISDKNKANRAKQVIKHTSRSKSYAQIRYEQD 994