BLASTX nr result
ID: Achyranthes22_contig00059410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00059410 (267 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK13835.1| mariner transposase [Beta vulgaris subsp. vulgaris] 65 1e-11 >gb|AFK13835.1| mariner transposase [Beta vulgaris subsp. vulgaris] Length = 517 Score = 65.1 bits (157), Expect(2) = 1e-11 Identities = 29/55 (52%), Positives = 43/55 (78%) Frame = +3 Query: 21 GKKRKGFDEDILKTIPYYKRTTIRQFASELEVSSNTIVRLMNKGVIRSHTSSIKP 185 G+K K D++ L+ +P +RTTIR FA+ LEVS +T+ RL+ +G++RSHT+SIKP Sbjct: 145 GRKVKFTDDEALRRVPLKQRTTIRSFATALEVSPSTVYRLLKRGILRSHTNSIKP 199 Score = 30.0 bits (66), Expect(2) = 1e-11 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 191 LKPHHKIARLEFVLKKIVPGTMVE 262 L P HK+AR++FVL + +P +M E Sbjct: 201 LTPKHKVARMKFVLSQSIPKSMNE 224