BLASTX nr result
ID: Achyranthes22_contig00059342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00059342 (343 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278790.1| PREDICTED: UPF0406 protein C16orf57 homolog ... 64 2e-08 ref|XP_002511033.1| conserved hypothetical protein [Ricinus comm... 62 8e-08 ref|XP_002322318.2| hypothetical protein POPTR_0015s12330g [Popu... 57 2e-06 ref|XP_006485013.1| PREDICTED: U6 snRNA phosphodiesterase-like [... 55 7e-06 >ref|XP_002278790.1| PREDICTED: UPF0406 protein C16orf57 homolog [Vitis vinifera] gi|147791224|emb|CAN70131.1| hypothetical protein VITISV_030399 [Vitis vinifera] gi|297737378|emb|CBI26579.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/50 (54%), Positives = 40/50 (80%) Frame = -1 Query: 208 KDPRLHISLAWALGDVSDLMRRVVQKTKKHLDVRGSLQKRIFTAKLWGAD 59 +DPR HISL WALG++SD ++R V++ ++H++V GS+QKRIFT K G + Sbjct: 218 EDPRPHISLVWALGNISDSLKRAVEEMRRHINVGGSVQKRIFTCKFNGIE 267 >ref|XP_002511033.1| conserved hypothetical protein [Ricinus communis] gi|223550148|gb|EEF51635.1| conserved hypothetical protein [Ricinus communis] Length = 288 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -1 Query: 208 KDPRLHISLAWALGDVSDLMRRVVQKTKKHLDVRGSLQKRIFTAKLWGAD 59 KDPR HISLAWALGD+SD ++RVV++ K + G +QKRIFT K G + Sbjct: 222 KDPRPHISLAWALGDISDSLKRVVEEEIKKSSIAGLVQKRIFTCKCRGIE 271 >ref|XP_002322318.2| hypothetical protein POPTR_0015s12330g [Populus trichocarpa] gi|550322561|gb|EEF06445.2| hypothetical protein POPTR_0015s12330g [Populus trichocarpa] Length = 290 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -1 Query: 208 KDPRLHISLAWALGDVSDLMRRVVQKTKKHLDVRGSLQKRIFTAKLWGAD 59 KDPR HISLAWALGDVSD+++R V K GS+ KR+F+ K G + Sbjct: 224 KDPRPHISLAWALGDVSDVLKREVVNEMKRSSAGGSILKRVFSCKFSGIE 273 >ref|XP_006485013.1| PREDICTED: U6 snRNA phosphodiesterase-like [Citrus sinensis] Length = 300 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = -1 Query: 208 KDPRLHISLAWALGDVSDLMRRVVQKTKKHLDVRGSLQKRIFTAKLWG 65 KDPR HISLAW LGDVS ++RVV + K L V SL K F+ K G Sbjct: 235 KDPRPHISLAWLLGDVSSSLKRVVVEEMKRLSVESSLHKHFFSCKFGG 282