BLASTX nr result
ID: Achyranthes22_contig00059140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00059140 (503 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004927726.1| PREDICTED: uncharacterized protein LOC101746... 55 7e-06 >ref|XP_004927726.1| PREDICTED: uncharacterized protein LOC101746905 [Bombyx mori] Length = 199 Score = 55.5 bits (132), Expect = 7e-06 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 7/87 (8%) Frame = +1 Query: 259 KVTYARSSPKNDVLHYTYVLSNKLGHLGTHGRSKKN------KDIKLRLVSWNIVSLTRK 420 K T AR+SP D V L HGR ++ ++I+LR SWN+ S+T K Sbjct: 7 KSTRARASPAGDAQGQHPVTVESGRGLSPHGRVRRKTQAQNVREIRLRYASWNVGSMTGK 66 Query: 421 SLELDEVMKKKKINILCLQE-REKAAR 498 EL +++K+++INI CLQE R K A+ Sbjct: 67 GRELVDLLKRRRINIACLQETRWKGAK 93