BLASTX nr result
ID: Achyranthes22_contig00058152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00058152 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEJ72569.1| putative reverse transcriptase family member [Mal... 58 1e-06 emb|CCH50976.1| T4.15 [Malus x robusta] 55 7e-06 >gb|AEJ72569.1| putative reverse transcriptase family member [Malus domestica] Length = 212 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/47 (61%), Positives = 32/47 (68%) Frame = +3 Query: 45 EKRMLR*MSEHTLKDKIRNEDIRKSIGVVNI*GNMIGNHIHLFGHMQ 185 E RMLR M HT KDKIRNEDIR +GV I GNM N + FGH+Q Sbjct: 101 EMRMLRWMCGHTRKDKIRNEDIRGKVGVAEIEGNMRENRLRWFGHVQ 147 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/47 (59%), Positives = 31/47 (65%) Frame = +3 Query: 45 EKRMLR*MSEHTLKDKIRNEDIRKSIGVVNI*GNMIGNHIHLFGHMQ 185 E RMLR M HT KDKIRNEDIR +GV I G M N + FGH+Q Sbjct: 875 EMRMLRWMCGHTRKDKIRNEDIRGKVGVAEIQGKMRENQLRWFGHVQ 921