BLASTX nr result
ID: Achyranthes22_contig00058101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00058101 (382 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468564.1| PREDICTED: GTP-binding protein ERG-like [Cit... 56 6e-06 ref|XP_006448614.1| hypothetical protein CICLE_v10015344mg [Citr... 56 6e-06 gb|EMJ12934.1| hypothetical protein PRUPE_ppa006209mg [Prunus pe... 56 6e-06 ref|XP_002516653.1| GTP-binding protein erg, putative [Ricinus c... 55 7e-06 >ref|XP_006468564.1| PREDICTED: GTP-binding protein ERG-like [Citrus sinensis] Length = 424 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 380 SKIGRIGMEANEQLRSIFNRNVHLILQVRLK 288 SKIGRIG+EANE+LRSIF R+VHLILQVRLK Sbjct: 393 SKIGRIGVEANEELRSIFKRDVHLILQVRLK 423 >ref|XP_006448614.1| hypothetical protein CICLE_v10015344mg [Citrus clementina] gi|557551225|gb|ESR61854.1| hypothetical protein CICLE_v10015344mg [Citrus clementina] Length = 424 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 380 SKIGRIGMEANEQLRSIFNRNVHLILQVRLK 288 SKIGRIG+EANE+LRSIF R+VHLILQVRLK Sbjct: 393 SKIGRIGVEANEELRSIFKRDVHLILQVRLK 423 >gb|EMJ12934.1| hypothetical protein PRUPE_ppa006209mg [Prunus persica] Length = 422 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 377 KIGRIGMEANEQLRSIFNRNVHLILQVRLK 288 KIGRIGMEANE+LRSIF R+VHLILQVRLK Sbjct: 393 KIGRIGMEANEELRSIFKRDVHLILQVRLK 422 >ref|XP_002516653.1| GTP-binding protein erg, putative [Ricinus communis] gi|223544148|gb|EEF45672.1| GTP-binding protein erg, putative [Ricinus communis] Length = 427 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 380 SKIGRIGMEANEQLRSIFNRNVHLILQVRLK 288 SKIGRIG+EANE+LRSIF R VHLILQVRLK Sbjct: 397 SKIGRIGIEANEELRSIFKREVHLILQVRLK 427