BLASTX nr result
ID: Achyranthes22_contig00057979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00057979 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522944.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002522942.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 gb|EXB50304.1| hypothetical protein L484_017842 [Morus notabilis] 57 2e-06 gb|EOY12365.1| Expression of the gene is downregulated in the pr... 55 8e-06 >ref|XP_002522944.1| conserved hypothetical protein [Ricinus communis] gi|223537756|gb|EEF39374.1| conserved hypothetical protein [Ricinus communis] Length = 130 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 292 VKITKQQLEELLGMMKMKQQGLLSSDQVLNQLVKVSAHTETYHHRSWRPRLQTIPE 125 +KITK+QLEELLG + M + LS +QVL QLVKVS + H RSWRP LQ+IPE Sbjct: 78 IKITKKQLEELLGRVDMNE---LSIEQVLVQLVKVSDSSFETHRRSWRPNLQSIPE 130 >ref|XP_002522942.1| conserved hypothetical protein [Ricinus communis] gi|223537754|gb|EEF39372.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -1 Query: 292 VKITKQQLEELLGMMKMKQQGLLSSDQVLNQLVKVSAHTETYHHRSWRPRLQTIPE 125 +KITK+QLEELLG + MK+ LS +QVL QL+KV + H RSWRP LQ+IPE Sbjct: 62 IKITKKQLEELLGRVDMKE---LSIEQVLAQLMKVGDPSFETHQRSWRPNLQSIPE 114 >gb|EXB50304.1| hypothetical protein L484_017842 [Morus notabilis] Length = 136 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = -1 Query: 292 VKITKQQLEELLGMMKMKQQGLLSSDQVLNQLVKVSAHTETYHHRSWRPRLQTIPE 125 +KITK+QLE+LLG M +K +S QVL QL+ VS +T RSWRP LQ+IPE Sbjct: 82 IKITKKQLEKLLGKMDVKD---MSVQQVLAQLISVSDKYQTQQIRSWRPALQSIPE 134 >gb|EOY12365.1| Expression of the gene is downregulated in the presence of paraquat, putative [Theobroma cacao] Length = 127 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = -1 Query: 292 VKITKQQLEELLGMMKMKQQGLLSSDQVLNQLVKVSAHTETYHHRSWRPRLQTIPE 125 VKITK+QLEELLG + +K+ LS QVL QL+ V ET RSWRP LQ+IPE Sbjct: 74 VKITKKQLEELLGRVDVKE---LSVQQVLAQLINVRNQYET-SQRSWRPALQSIPE 125